(data stored in ACNUC7421 zone)

EMBL: CP000947.PE142

CP000947.PE142       Location/Qualifiers
FT   CDS_pept        complement(154034..155242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0144"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; KEGG: hso:HS_0271 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31185"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK5"
FT                   /protein_id="ACA31185.1"
FT                   /translation="MMNYSQTIIIGAGAAGLFCAGQLGKAKHQVTILDNGKKVGRKILM
FT                   SGGGFCNFTNLNVTPQHYLSQNPHFVKSALARFTQWDFIALITDYGISYYEKESGQLFC
FT                   HNSAEDIVNMLRAECDKFQVNTQLRQQIEYIEKLDGNEKARFQLQSDGKIWQCENLVIA
FT                   TGGLSMPALSSTPFGYQVAEQFGLNVIAPRAGLVPFTWREIDKFYTALSGISLPVCVTA
FT                   KCGQSFSNNLLFTHRGISGPAILQISNYWQVNENIEIDLLPMENIQFFLNKLRQTSPKL
FT                   HLKTALSRLLPQKLVDLWLNHNIIQDEVIANLSKVQLKNLDDLIHHWQIQPNGTEGYRT
FT                   AEVTIGGVDTQEISSKTMESHKIKGLYFIGEVLDVTGRLGGYNFQWAWSSAYVCANGIL
FT                   SNK"
     atgatgaatt attcccaaac aattattatc ggtgcaggtg cggcaggctt gttttgtgcc        60
     ggtcaactag gtaaagccaa gcaccaagta acgattttag ataatggaaa aaaagtggga       120
     cgtaaaattt taatgtccgg tggcggattt tgtaatttta ccaaccttaa tgttacccct       180
     cagcattacc tttcgcaaaa tcctcatttc gtcaagtctg ctctagctcg ctttacccaa       240
     tgggatttta ttgccctcat tactgactat ggtattagct attatgaaaa agaatcgggg       300
     caactttttt gtcataacag tgctgaagat attgtcaata tgctacgagc agaatgcgat       360
     aaatttcaag ttaataccca attacgtcaa cagatcgaat acattgaaaa attagacggt       420
     aatgaaaaag ctcgttttca attgcaatct gacggaaaaa tttggcaatg tgaaaattta       480
     gttattgcta ccggcggatt gtctatgcca gccttgagtt cgacaccttt cggttaccaa       540
     gttgccgaac aattcggact caatgttatt gctccacgag ctgggcttgt acccttcaca       600
     tggcgtgaaa ttgataaatt ttacaccgca ctttcaggca tctcccttcc tgtttgtgta       660
     accgcaaagt gcggtcaatc tttcagcaat aatttactct tcactcatcg ggggatatca       720
     ggtcccgcta ttttacaaat ttcaaattat tggcaagtga atgaaaatat agaaattgat       780
     ctgttaccga tggaaaatat tcaatttttc cttaacaagt tacgtcagac ctcacctaaa       840
     ttacatttaa aaaccgcctt atcacgccta ttaccgcaaa aactagtgga tttatggtta       900
     aatcacaaca ttattcaaga tgaagtgatt gccaacctca gtaaagtgca gttaaaaaat       960
     cttgatgatt taattcatca ttggcaaatt caacctaacg gcaccgaagg ctatcgcacc      1020
     gcagaagtca ctattggagg cgtagatacg caagaaatct catcaaaaac gatggaaagt      1080
     cataaaatca aaggtcttta ttttattggt gaagtacttg atgttaccgg tcggcttggc      1140
     ggttataact tccaatgggc atggagctca gcctatgtgt gtgcaaatgg aattttgagc      1200
     aataaatag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page