(data stored in ACNUC7421 zone)

EMBL: CP000947.PE145

CP000947.PE145       Location/Qualifiers
FT   CDS_pept        157852..159330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0147"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: hso:HS_0274 ribonuclease
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31218"
FT                   /db_xref="GOA:B0UVK8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK8"
FT                   /protein_id="ACA31218.1"
FT                   /translation="MMESVELLANITPSETRIALVDNGILKEVHIERQAKRGSVGNIYK
FT                   GRVTRVLPGMQSAFVDIGLEKAAFLHASDIVSHTECVDVDEQKQFVVKDIAQLVHEGQD
FT                   IVVQVVKDPLGTKGARLTTDITLPSRYLVFMPENSHVGVSQRIESEEERARLKELVLPL
FT                   CDELGGFIIRTAAEGATETELVQDAEFLKRLWRKVLERRAKYTTRSMLYGELALTQRIL
FT                   RDFIGANFSKIHIDSKLCFSEVKQFTEEFMPELTDKLVLYSGSQPLFDVYSVENAIQTA
FT                   LNSRVNLKSGGYLIIEQTESMTTIDINTGAFVGHRNLEETIFNTNIEATKAIAQQLQLR
FT                   NLGGIIIIDFIDMQTEEHRDRVLESLRLALSKDRVKTNVNGFTQLGLVEMTRKRTRESL
FT                   EHILCDECPTCSGRGSVKTVETVCYEIMREIIRVNHLFASEKFVVYASRAVADYLINEE
FT                   SHGLLAELEVFIGKQIQIKTEVYYSQEQFDVVVM"
     atgatggaat ctgttgaatt attggctaac attaccccta gtgaaacccg aattgcactg        60
     gtggataatg gcattttaaa agaagtacat attgaaagac aggcaaaaag agggagcgtc       120
     ggtaatattt ataaaggacg agtgactcga gtattgccgg gtatgcaatc tgcatttgta       180
     gatatcggat tggaaaaagc cgctttttta catgcctcag atattgtttc acatacagag       240
     tgtgttgatg ttgatgagca aaaacagttt gtagtgaaag atattgcaca attggtacat       300
     gaaggacagg atattgttgt tcaggttgtc aaagatcccc tcggtactaa aggtgcaaga       360
     ttaacaactg acataacact cccttctcgt tatcttgttt ttatgccgga aaatagccat       420
     gttggcgttt ctcaacgcat tgaaagcgaa gaagagcggg cacgtttaaa ggaacttgtt       480
     ttaccgttgt gcgatgaatt gggcggtttt atcattcgta ctgctgcgga aggagcaacg       540
     gaaactgaac tcgtacaaga tgcggagttt ttaaaacgct tatggcgtaa ggtgttggaa       600
     cgccgtgcga aatatacaac acgttcaatg ttatatggcg aattggcgtt aacgcaacgt       660
     attttgcgag attttatcgg ggcgaatttc agtaaaattc atattgattc caaattatgt       720
     ttttctgaag tgaaacagtt tactgaggaa tttatgcctg aactgacaga taagttggtg       780
     ttatattccg gcagtcagcc attatttgat gtttatagcg ttgaaaatgc tattcaaaca       840
     gctttaaata gtcgtgtaaa cttaaaatcc ggtggctatc taattattga acaaaccgaa       900
     tctatgacaa cgatagacat taatactggt gcttttgttg gtcatcgtaa tttagaagaa       960
     actattttta atacgaatat tgaggcaaca aaagctattg cacaacagtt acaactacgc      1020
     aatctgggcg gtattattat tattgatttt attgatatgc aaacggaaga acatagggat      1080
     cgtgtcttgg aatctttacg tttggcatta tccaaagata gagtgaaaac gaatgttaat      1140
     gggtttactc aacttggttt agttgaaatg acacgtaagc gaacaaggga aagtttggag      1200
     catattttat gcgatgaatg tccaacttgc agtggacgag gcagtgtgaa aaccgttgaa      1260
     acggtttgtt atgaaatcat gcgtgaaatt attcgtgtta atcatttatt tgccagcgaa      1320
     aaatttgtag tttatgcctc aagagcggtg gcggattatt taattaatga ggaaagccat      1380
     ggtttattag cagagttgga agtcttcatt ggcaaacaaa ttcaaataaa aacagaagtg      1440
     tattattcac aggaacaatt tgatgttgtt gtaatgtaa                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page