(data stored in ACNUC7421 zone)

EMBL: CP000947.PE15

CP000947.PE15        Location/Qualifiers
FT   CDS_pept        11602..12264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0015"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   hso:HS_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31251"
FT                   /db_xref="GOA:B0UUX3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX3"
FT                   /protein_id="ACA31251.1"
FT                   /translation="MEGAVLAIKLGLVEEIVFENGSKMSTAIRKKPMEQAIVHELGAEG
FT                   NDVGLKAHHGGIDKALFFMAERSFAKLTALLGKHDSYQGEAIYGENFIVSFFDEENVCV
FT                   GDQYQIGDVQIEISQPRIPCETLSKNANNKNTRAIVVETGLTGWYVRVIKNGVIKKGDK
FT                   IRRLANPYPKLTIKYLNYLLATEATVELKTQLEQAIECPVLAEAFKRYLKMKWRKIS"
     gtggaaggtg ctgttttagc gattaaattg ggattggttg aagagattgt ttttgaaaat        60
     ggttcaaaga tgtcaacggc aattcggaaa aaaccgatgg aacaagctat cgttcatgaa       120
     ttaggtgcgg aaggaaatga tgttggactg aaagcacatc atggaggcat tgataaagca       180
     ctgtttttta tggctgaaag atcttttgct aaattaaccg ctcttttggg taagcatgat       240
     agctatcaag gagaagctat ctatggtgaa aattttattg tttctttttt tgatgaagaa       300
     aatgtatgtg tcggcgatca gtaccagatc ggagatgtac aaattgaaat ttcacaacct       360
     cgcatacctt gtgaaacgtt gtcaaaaaat gccaataata aaaatactcg agcgattgtt       420
     gtagaaacag ggctgaccgg ttggtatgtg agagtcatta aaaatggcgt gatcaaaaaa       480
     ggggataaaa tccggcgttt agctaaccct tacccaaaat taaccattaa atatttaaat       540
     tatttgctgg caacggaagc gactgtggag cttaaaactc aattagaaca agcaattgaa       600
     tgtcctgttt tggcggaggc ttttaagcgt tacttaaaaa tgaaatggcg aaaaatcagt       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page