(data stored in ACNUC7421 zone)

EMBL: CP000947.PE151

CP000947.PE151       Location/Qualifiers
FT   CDS_pept        165268..165675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0153"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; iron-sulfur cluster assembly transcription factor
FT                   IscR; PFAM: protein of unknown function UPF0074; KEGG:
FT                   hso:HS_0280 possible transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31285"
FT                   /db_xref="GOA:B0UVL4"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL4"
FT                   /protein_id="ACA31285.1"
FT                   /translation="MKLTSKGRYAVTAILDIALNAELGPVSLADISERQHISLSYLEQL
FT                   FAKLRRGGLVKSVRGPGGGYQLGLSTDQISIGMVINAVNENINVTKCLGNGDCQGGVKC
FT                   LTHSLWEELSVRIENFLNEITIAELVAKQAK"
     atgaaattaa catcaaaagg gcggtatgcg gtaacagcta ttttggatat tgcgttaaat        60
     gctgagcttg gacctgttag tttagcggat atctctgaac gacagcatat ttccctttct       120
     tatttagaac agctttttgc taaattacgc cgtggtggtt tagtgaaaag tgtgcgtggt       180
     cctggtggcg ggtatcagtt aggattatct actgatcaga tctccattgg catggtaatt       240
     aacgcagtta atgaaaatat taacgttaca aaatgtttgg ggaatggcga ttgtcagggg       300
     ggagtaaaat gcttaactca ttctttgtgg gaagaattga gtgtacgaat tgaaaatttc       360
     ttaaatgaaa taacgattgc agaattagtt gcaaaacaag ccaagtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page