(data stored in ACNUC7421 zone)

EMBL: CP000947.PE152

CP000947.PE152       Location/Qualifiers
FT   CDS_pept        165754..166968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0154"
FT                   /product="cysteine desulfurase IscS"
FT                   /note="TIGRFAM: cysteine desulfurase IscS; PFAM:
FT                   aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   hso:HS_0281 cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31296"
FT                   /db_xref="GOA:B0UVL5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVL5"
FT                   /protein_id="ACA31296.1"
FT                   /translation="MKLPIYLDYAATCPVDERVVKKMMEFLSIDGNFGNPASRSHKFGW
FT                   QAEEAVDVARNHIADLIGADSREIVFTSGATEADNLALKGVMRFYQTKGKHLITCKTEH
FT                   KAILDTCRQLEREGFEVTYLDPKSDGLIDLEELKSVIRDDTVLVSIMHANNEIGVVQDI
FT                   AKIGEICRERKVLFHTDATQSVGKLPINLSELKVDLLSMSSHKLYGPKGIGALYVCRKP
FT                   RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLTALRDRLYNGL
FT                   KDIEETYVNGSMEQRLGNNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLR
FT                   ALGLNDELAHSSIRFTVGRYTTEEEIDYSIGLVKSAVKKLRDLSPLWDMFKEGIDLNSI
FT                   EWTHH"
     atgaaattac ctatttattt agattatgcg gcaacttgcc ctgtggatga acgtgtagtg        60
     aagaaaatga tggagttttt aagcattgat ggaaattttg gaaacccggc atctcgctca       120
     cataaatttg gttggcaggc tgaagaagcg gttgatgttg ctcgcaatca tattgctgat       180
     ttaatcggtg cggacagtcg tgagattgtt tttacttctg gtgcaacaga agcggacaac       240
     cttgcattga aaggagtgat gcgtttctat caaactaaag ggaaacatct tattacctgt       300
     aaaactgaac ataaagcgat cttagacact tgtcgccagc ttgaacgtga agggtttgaa       360
     gtgacttatt tagatcccaa atcagatggt ttgatagatt tagaggaatt aaaatccgtt       420
     attcgtgatg acacggtttt ggtttctata atgcacgcca ataatgagat tggtgtagta       480
     caggatattg ctaaaattgg tgaaatttgc cgtgaacgta aggtattatt tcacaccgat       540
     gcaactcaat ccgtcggtaa attgcccatt aatttgagtg aattaaaagt agatttactt       600
     tctatgtcca gtcataaatt atatggacct aaaggtatag gtgctttata tgtttgccgt       660
     aaaccacgag ttcgtttgga ggcaattatt catggcggcg gtcatgagcg tggtatgcgt       720
     tcaggaacct tacctgtaca tcagattgtg ggcatgggtg aagcatatcg tattgctaaa       780
     gaagaaatgg caacagaaat gccacgctta accgctttgc gtgatcgttt atataacggc       840
     ttaaaagata ttgaagaaac ctatgtaaac ggttcaatgg aacaacgttt aggtaataat       900
     ttaaatatta gttttaatta cgttgaaggt gaaagtttaa tgatggcgtt acgagatatt       960
     gcggtatctt ccggttctgc ctgtacatcg gcaagtctcg agccttctta tgttttgcgt      1020
     gccttagggt taaatgacga attggcacat agctcaattc gttttactgt ggggcgttat      1080
     actacggaag aagaaattga ttattctatc ggtttagtta aaagtgcggt gaaaaagtta      1140
     cgtgatttat ctccactttg ggatatgttc aaagagggta ttgatttaaa cagtattgaa      1200
     tggactcatc attaa                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page