(data stored in ACNUC7421 zone)

EMBL: CP000947.PE153

CP000947.PE153       Location/Qualifiers
FT   CDS_pept        167045..167428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0155"
FT                   /product="FeS cluster assembly scaffold IscU"
FT                   /note="TIGRFAM: FeS cluster assembly scaffold IscU; PFAM:
FT                   nitrogen-fixing NifU domain protein; KEGG: hso:HS_0282
FT                   iron-sulfur cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31307"
FT                   /db_xref="GOA:B0UVL6"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL6"
FT                   /protein_id="ACA31307.1"
FT                   /translation="MAYSEKLLDHYENPRNVGSFDKKDPTVGSGMVGAPACGDVMQLQI
FT                   KVNDEGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLDEAQAIKNSQIAEELELPPVKV
FT                   HCSILAEDAIKAAIADYKAKKAE"
     atggcatata gcgaaaaatt acttgatcat tatgaaaatc ctcgtaatgt aggttcgttt        60
     gataaaaaag atccgacagt cggtagcggt atggttggtg cacctgcttg tggtgatgtc       120
     atgcaattac aaattaaagt aaatgatgaa ggtatcattg aagatgctaa atttaaaacg       180
     tatggttgtg gttcggcaat tgcgtcaagt tccttaatca ctgaatgggt gaaaggtaaa       240
     tctttagatg aagcccaagc gattaagaat agccaaattg ctgaagagtt ggaattgccg       300
     ccggttaaag tgcattgctc aattcttgca gaagatgcga ttaaagctgc aattgctgat       360
     tataaagcga aaaaagctga atag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page