(data stored in ACNUC7421 zone)

EMBL: CP000947.PE154

CP000947.PE154       Location/Qualifiers
FT   CDS_pept        167594..167917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0156"
FT                   /product="iron-sulfur cluster assembly protein IscA"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; iron-sulfur cluster assembly protein IscA; PFAM:
FT                   HesB/YadR/YfhF-family protein; KEGG: hso:HS_0283
FT                   HesB-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31318"
FT                   /db_xref="GOA:B0UVL7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL7"
FT                   /protein_id="ACA31318.1"
FT                   /translation="MSITLTQAAANRVRTFLEKRGKGIGLRLGIKTSGCSGLAYVLEFV
FT                   DVLNEDDEVFEQDGVKVIVDHKSLVYLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGES
FT                   FNV"
     atgagtatca ccttaacaca agcagctgca aaccgagttc gtactttttt agaaaaaaga        60
     ggaaaaggaa taggtttacg tttagggatt aaaacgtcag gttgctcagg cttagcttat       120
     gttttagagt tcgttgatgt tttaaatgaa gatgatgagg ttttcgagca agatggcgtt       180
     aaggtgattg tggatcataa gagcttagtc tatttagacg ggactcaact ggattttgtc       240
     aaagagggac taaatgaagg ctttaaattt agtaatccga atgtaaaaga tgaatgtggt       300
     tgtggtgaaa gtttcaacgt atag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page