(data stored in ACNUC7421 zone)

EMBL: CP000947.PE155

CP000947.PE155       Location/Qualifiers
FT   CDS_pept        167930..168448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0157"
FT                   /product="co-chaperone Hsc20"
FT                   /note="TIGRFAM: co-chaperone Hsc20; PFAM: heat shock
FT                   protein DnaJ domain protein; HSCB oligomerisation domain
FT                   protein; KEGG: hso:HS_0284 co-chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31329"
FT                   /db_xref="GOA:B0UVL8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVL8"
FT                   /protein_id="ACA31329.1"
FT                   /translation="MINPFALFDLEIDFNLDQQILSQRYLTLQKSLHPDNFAHRSAQEQ
FT                   RLALQKSAEINDALQILKDPISRADSIINLHLGEQNIEQKTNQDMMFLMQQMAWRERLE
FT                   QVEQQQNMDKLLHFSQEVECVQRDILAELQEFLAQQNWQQAQLLNDRLRFIKKLFVEIE
FT                   RVEEQLAGF"
     atgataaatc catttgcgtt atttgatttg gaaattgatt ttaatcttga tcaacaaata        60
     ctctcacagc gttatttaac gctacaaaaa tctttgcatc ctgataattt tgctcataga       120
     tctgcccaag aacaacgttt agcactgcaa aaatctgctg aaattaatga tgctttacaa       180
     atactgaaag atcctatcag tcgtgctgat agtataatca atttgcatct tggtgaacaa       240
     aatatagagc aaaaaactaa tcaagatatg atgtttttga tgcagcaaat ggcatggcga       300
     gaacggttgg agcaagttga gcaacaacaa aatatggata agttattaca cttctcgcaa       360
     gaggtcgagt gtgtacaacg tgatatttta gcggagctac aagaatttct ggcacaacaa       420
     aattggcaac aagctcaatt gctaaatgat cgtttacgtt ttattaaaaa attatttgtt       480
     gaaattgaac gggttgaaga acagttagct ggtttttag                              519
//

If you have problems or comments...

PBIL Back to PBIL home page