(data stored in ACNUC7421 zone)

EMBL: CP000947.PE156

CP000947.PE156       Location/Qualifiers
FT   CDS_pept        168490..170340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0158"
FT                   /product="Fe-S protein assembly chaperone HscA"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: Fe-S protein assembly chaperone HscA; PFAM:
FT                   Heat shock protein 70; KEGG: hso:HS_0285 chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31340"
FT                   /db_xref="GOA:B0UVL9"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVL9"
FT                   /protein_id="ACA31340.1"
FT                   /translation="MALLQIAEPGQSAAPHQHKLAVGIDLGTTNSLVAAVRSGSSEVLR
FT                   DEQDRLLIPSIVHLTEDQAIVGYEAGQLASQDPQNTIISVKRLIGRSCTDVQQRYPNLP
FT                   YQFNATENGLPLLKTRRGLLSPVEISAEILKKLTALAEQRLGGELTGAVITVPAYFDDA
FT                   QRQSTKDAAKLAGLKVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGTFDVSILRLSK
FT                   GVFEVLATGGDTALGGDDFDHLLAEWIVKKSTVAPQNDREKRQLIEVANQVKVALTTND
FT                   KIRISYAEQNLEIMRDEFNFLISGLVKRSLLACRRTLKDANLTPSDILEVVMVGGSTRI
FT                   PYVREQVGEFFQCTPLTSIDPDKVVALGAAIQADILVGNKPDSEMLLLDVIPLSLGIET
FT                   MGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMSVHVLQGEREMVTDCRSLARFTLRGI
FT                   PAMVAGAARIRVTYQVDADGLLSVTAVEKSTGVQASTQVKPSYGLTDDEIANMLKSSME
FT                   HAKEDIQTRLLTEQRVDATRVIESVYSALQQDEDLLDDNELSAVKNALVSLQKLIQEED
FT                   SLAIKQGIKMLDQATQEFASRRMDKSIRRALSGQHIEHIK"
     atggcattac ttcaaattgc ggagccaggg caaagtgcgg caccgcacca acataaatta        60
     gctgtaggta ttgatttggg gacaacaaac tctttggttg cagctgtgcg tagtggaagt       120
     agtgaagttt tgcgggacga acaggatcgc ttgcttattc catcgatagt tcatttaaca       180
     gaagatcaag cgattgtggg gtatgaggca ggtcaacttg ccagtcaaga tccgcaaaat       240
     accattattt ccgtgaagcg tttaattgga cgtagttgta ctgatgtaca gcaacgttat       300
     cctaatttgc cttatcaatt taatgcaact gaaaatggct tacctctatt aaagacaaga       360
     cggggattat taagtccggt agaaatttca gccgaaattt tgaaaaaatt gaccgcactt       420
     gctgagcaac gtttgggtgg agaattaact ggtgcagtga ttactgttcc tgcttatttt       480
     gatgatgctc aacgacaaag taccaaagat gctgcaaagt tagcaggttt aaaggtattg       540
     cgtttactta atgagccaac cgcagctgcc atcgcttatg gtttggatag tggacaagaa       600
     ggtgtgattg ctgtttatga tttaggcggc ggtacttttg atgtgtccat tttacgctta       660
     tccaaaggtg tgtttgaagt gcttgctacc ggaggtgata ccgcacttgg tggtgatgat       720
     tttgatcatt tattagcgga gtggattgta aaaaaatcaa cagtcgcacc tcaaaatgat       780
     cgtgaaaaac gtcaacttat tgaagtcgca aaccaagtca aagttgcttt gaccacgaac       840
     gataaaatcc ggatttctta tgcagagcaa aatctggaaa ttatgcgtga tgaatttaat       900
     tttctgattt caggtttagt caaacgttca ttattagctt gtcgtcggac gttaaaggat       960
     gccaatttaa ctccatcaga tatattggaa gtagtgatgg tgggcggttc aacgcgtatt      1020
     ccttatgtta gagaacaagt tggtgagttt ttccaatgta caccgctgac ttctattgac      1080
     cctgataaag tggtggcatt aggtgcagct attcaggcgg atattttagt aggaaataag      1140
     cctgatagtg aaatgttatt gctcgatgtg attccgttgt cattaggtat tgaaactatg      1200
     ggaggcttgg ttgagaagat tattcctcgt aatactacta ttccggtagc aagagcacag      1260
     gaatttacta cattcaaaga tgggcaaaca gctatgtcgg tgcatgtgtt acaaggtgaa      1320
     cgtgaaatgg ttactgattg tcgctctttg gctcgtttta ctttacgagg tattccggct      1380
     atggtggcag gtgcagcacg tattcgagtc acttatcaag ttgatgctga tgggttatta      1440
     agtgttactg cggtggaaaa atcaacagga gtacaagcat caactcaagt aaaaccttcc      1500
     tatggtttaa ctgatgatga aattgctaat atgctaaaat cctcaatgga gcatgctaaa      1560
     gaagatattc aaactcgttt actaacagaa cagcgtgttg atgctaccag agtcattgaa      1620
     agtgtttatt cggcattaca gcaagatgaa gatcttttag atgataatga attaagtgcg      1680
     gttaaaaatg ccttagtttc attacaaaaa ttgattcaag aagaagatag ccttgctatt      1740
     aagcaaggga taaaaatgct tgatcaagca acgcaagaat ttgcctctcg ccgtatggat      1800
     aaatctattc gtcgagcatt aagcgggcaa catattgaac atattaaata a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page