(data stored in ACNUC7421 zone)

EMBL: CP000947.PE158

CP000947.PE158       Location/Qualifiers
FT   CDS_pept        170828..173101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0160"
FT                   /product="glutamate--cysteine ligase, putative/amino acid
FT                   ligase, putative"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutamate--cysteine ligase, putative/amino
FT                   acid ligase, putative; PFAM: phosphoribosylglycinamide
FT                   synthetase; glutamate--cysteine ligase; KEGG: hso:HS_0287
FT                   glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31363"
FT                   /db_xref="GOA:B0UVM1"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR006335"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR040657"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM1"
FT                   /protein_id="ACA31363.1"
FT                   /translation="MKIQHLIKQHQLGLLFQQGSFGLEKESQRVYQDGSVVTTEHPKCF
FT                   GNRSYHPYIQTDFAESQLELITPPNKNLEDSLRWLSAIHEVVLRSLPEDEFIFPLSMPA
FT                   GLPSDELIKVAQLDNPEDVAYREHLVQSYGKNKQMVSGIHYNFQLAPELIQTLFDLQQE
FT                   QKSAVDFQNNLYLKMAKNFLRYQWVLLYLLSATPTVESNYFKGSSPLGKGEYVRSLRSS
FT                   KYGYVNDPEVIVSFDSLEQYAESLEHWVKSGKLIAEKEFYSNVRLRGAKKARDLIQNGI
FT                   KYLEFRLFDLNPFEQYGMSLADARFIHHFVLLMIWLDEMPDQQGVELGRSRLAEVALEN
FT                   PLAQTAYREEGEWLLNQLISMLQSIGADQSAVSFVREKLAQFADPGLTLCGRLVQEIEQ
FT                   KGGYQKLGAELAKQYKENAFERFYALTAFDNMELSTQALMFDLIQQGISFEILDERDQF
FT                   LRLQFGEHVEYVKNGNMTSKDSYISPLIMENKVVTKKVLEKAGFNVPQSQEFTSVKQAI
FT                   VGYSLFEKRAVVIKPKSTNYGLGITIFQQGVNNREDFAKAVEIAFREDKEIMVEDYLVG
FT                   TEYRFFVLGEETLAVLLRVPANVVGDGIHTVAELVAQKNAHSLRGDGSRTPLKKIALGD
FT                   IEQLQLKEQGLTVESIPAKDQIVQLRANSNISTGGDSIDITDEMHLSYKQLAVGIAKAM
FT                   GAAVCGVDLIISDLKEPAQPDLSSWGVIEANFNPMMMMHIFPYAGQSRRLTRNVINMLF
FT                   PEVK"
     atgaaaatcc aacatttaat taagcaacat caacttggct tattgtttca acaaggctcc        60
     tttggtttag aaaaagaaag ccaacgagtt tatcaagacg gttcggtagt aacaaccgaa       120
     caccctaaat gttttggtaa cagatcttac catccctaca ttcaaactga ttttgcggaa       180
     agtcagctcg aattgatcac gcctcccaat aaaaatttag aagatagttt aagatggtta       240
     tccgctattc atgaagttgt tttgcgttct ttgcctgagg atgaatttat ttttccgttg       300
     agtatgccgg caggattgcc ttcagatgaa ttgataaaag tcgctcaatt ggataaccct       360
     gaagatgtgg catatcgtga acatttagtt cagtcttatg gaaaaaataa acaaatggtc       420
     agtggaatcc attataactt tcagttggct ccggaactca ttcaaacctt atttgattta       480
     cagcaagagc aaaaaagtgc ggtagatttt cagaataatt tatacttgaa aatggcgaaa       540
     aattttcttc gttatcaatg ggttttattg tacttattat cagcaacacc aacggtagag       600
     agtaattatt ttaaaggtag ttcgccatta ggaaaaggtg aatatgttcg cagtttacgt       660
     tcaagcaaat atggttatgt gaatgatcct gaggtcattg tttcttttga tagtttagaa       720
     caatatgcag aaagtctgga gcattgggtt aaaagcggaa aactgatagc agagaaagaa       780
     ttttattcca atgtgcgttt acgaggtgcg aaaaaggcga gagatttaat tcaaaatgga       840
     attaaatatt tagaatttcg cttgtttgat ctcaatcctt tcgagcaata cggtatgagc       900
     cttgcggatg caagatttat tcatcatttt gtactattga tgatttggct tgatgaaatg       960
     ccagatcaac aaggtgttga actggggcgt agccgtctag cggaagtagc tctagaaaat      1020
     ccgttggcac aaactgccta tcgagaagaa ggtgagtggt tacttaatca gttaatcagt      1080
     atgttacaaa gtatcggggc agaccaaagt gcggtgagtt ttgtccgaga aaaattagct      1140
     caatttgctg atcccgggtt gacgttatgt ggtcgtttag tccaagaaat tgagcagaaa      1200
     ggcggttatc aaaaattagg tgcagagctt gccaaacaat ataaagaaaa tgcttttgag      1260
     cgtttttatg cgttaaccgc ttttgataac atggaacttt caactcaagc cttaatgttt      1320
     gatttaattc agcaaggtat cagttttgag atcttggatg aacgagatca atttttacgc      1380
     ttacaatttg gtgaacatgt tgaatatgta aaaaatggta atatgacttc gaaagatagc      1440
     tatatttctc ctcttattat ggaaaataaa gtggttacga aaaaagtatt ggaaaaggcg      1500
     gggtttaatg ttccacagag tcaggagttt acttcagtta aacaagcgat agtcggttat      1560
     agcctgtttg aaaaaagagc ggtcgttatt aaacctaaat ctactaacta tggcttgggg      1620
     attacaattt ttcagcaagg tgtgaataat agagaagatt ttgccaaggc agtggaaatt      1680
     gcgttccgtg aagataaaga aattatggtg gaggattatt tagttggtac tgaataccgc      1740
     ttctttgtgt tgggtgagga aacattggca gttttattac gtgttccggc aaatgtagta      1800
     ggcgatggca ttcatactgt ggctgaattg gtagctcaaa aaaatgctca ctcattgcgt      1860
     ggtgatggta gtcgtacgcc attgaaaaaa attgcattag gcgatattga gcaattgcag      1920
     ttgaaagagc aaggtttgac tgttgagagt attccagcta aagatcaaat tgttcagttg      1980
     cgggcaaatt ctaatattag tacaggcggt gacagcattg atataactga tgaaatgcat      2040
     ttgagttata aacaactggc ggtggggatt gcaaaagcta tgggggctgc tgtgtgcggt      2100
     gtggatctga ttatttccga tttgaaagaa ccggcacagc ctgatttaag ttcttggggc      2160
     gtaattgaag cgaattttaa tccaatgatg atgatgcaca tcttccctta tgccggacaa      2220
     tctagaagat taacaagaaa tgtgattaac atgttgtttc cggaagtaaa gtaa            2274
//

If you have problems or comments...

PBIL Back to PBIL home page