(data stored in ACNUC7421 zone)

EMBL: CP000947.PE160

CP000947.PE160       Location/Qualifiers
FT   CDS_pept        complement(174119..175378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0162"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na dependent
FT                   nucleoside transporter; nucleoside recognition domain
FT                   protein; Na dependent nucleoside transporter domain
FT                   protein; KEGG: hso:HS_0289 transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31385"
FT                   /db_xref="GOA:B0UVM3"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM3"
FT                   /protein_id="ACA31385.1"
FT                   /translation="MSSLISIIGIFALLLIAFLLSNNRKAINYRTVLGALLIQFLFGAF
FT                   ILYVPVGRQALQSVAGAVQSVINYGNEGIRFLFNGLAPQADGSMGSAGFVFVINVLPNI
FT                   VFFSALISLLYYIGVMQWLIKIIGGALQKALGTSKSESMSAAANIFVGQTEAPLVIKPY
FT                   ISKMTESELFAVMCGGLASIAGSVMAGYAGMGVPLTYLIAASFMAAPAGLLFAKILIPQ
FT                   TEKFNDNFEQIQQEKPTNILDAAAGGASSGMQLALNVGAMLIAFVALIALLNGILGTIG
FT                   NWIGQEGLSLGMIFGWVFKPLAFIIGVPWEEAEIAGRMIGTKLAINEFVGYLDFVPYLA
FT                   ADAAVQLSDKTKAIITFALCGFANFSSIAILIGGLGAMAPNRRGDIARLGIKAVIAGSL
FT                   ANLMSATIAGLFIGLSGAAL"
     atgagttctc tgattagcat tatcggtatc ttcgctttat tattaatagc ctttctttta        60
     tctaataatc gtaaggcgat taattatcgt acagtgctag gtgcactatt aattcaattt       120
     ttatttggtg catttattct ttatgttccc gttggtcgtc aggcactaca aagcgttgca       180
     ggagcagtac aatcagtcat caattatggt aatgaaggga tccgttttct atttaatggg       240
     ttagcgccac aagccgatgg ttctatgggc tcagccggtt ttgttttcgt tatcaacgtc       300
     cttccaaata ttgttttctt ctccgcatta atctccctac tttactatat cggtgtaatg       360
     caatggctga ttaaaatcat cggcggagca ttacaaaaag cattaggcac atcaaaatcc       420
     gagtctatgt cggcagcagc caatatcttc gtgggacaaa cagaagcccc cttagtcatt       480
     aaaccttata ttagcaaaat gacagaatca gagctgtttg cagtaatgtg cggtggttta       540
     gcctctatcg ctggttcagt catggctgga tatgccggaa tgggtgtgcc tctaacctat       600
     ctaatcgcag cttcatttat ggctgctcca gccggattgt tatttgctaa aattcttatc       660
     ccacaaactg aaaaatttaa tgataatttc gaacaaatac aacaagaaaa accaacaaat       720
     attcttgatg cagccgccgg aggtgcatca tctggtatgc aacttgcctt aaatgtgggt       780
     gcgatgttga tcgcatttgt ggctttaatt gcattactta acggaattct tggcactatc       840
     ggaaactgga ttggtcaaga aggactttct cttggcatga tctttggttg ggttttcaag       900
     ccgttagcct tcattattgg ggttccttgg gaagaagcgg aaattgctgg tcgtatgatt       960
     ggaaccaaat tagcaattaa tgaatttgtt ggttatttag attttgtacc ataccttgca      1020
     gctgatgcag cggtgcaact aagtgataaa actaaagcaa ttattacttt tgccctctgt      1080
     ggatttgcaa actttagctc tattgcaatt ttaatcggtg gcttaggggc aatggcacca      1140
     aatcgtcgtg gtgatattgc tcgcttaggt attaaagcgg taattgccgg ttcattagca      1200
     aacttaatga gtgcaacaat tgcaggtcta tttattggat taagcggtgc tgcactgtaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page