(data stored in ACNUC7421 zone)

EMBL: CP000947.PE161

CP000947.PE161       Location/Qualifiers
FT   CDS_pept        175554..176198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0163"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   hso:HS_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31396"
FT                   /db_xref="GOA:B0UVM4"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM4"
FT                   /protein_id="ACA31396.1"
FT                   /translation="MKKFNELPQTPWAAKSLWEIETKSLLVLCFSLSLLGIGDGLLVLS
FT                   NLGSAPWTVLSQGIALQAQFSVGWASFIVSILVMLMWIPLRLKVGFGTILNVVLIALFL
FT                   GLSIFYISPPSSLLARFCYLITGIIFFGIGTAFYLTCHQGAGPRDGLMVGLCHRFKLRI
FT                   GIVRTLMEVSVCFLGFLLGGTVGIGTLLFATSIGWIIQLGVYFIMKLNKSV"
     atgaaaaaat ttaatgagct tcctcaaact ccttgggctg ccaaatcttt gtgggaaata        60
     gaaacaaagt cgctattggt attatgtttt tcactttcct tgctcggtat tggtgatgga       120
     ttgttggttt tatccaattt aggctctgca ccttggacag ttttgtctca aggcattgct       180
     ttacaagcac aatttagtgt tggctgggca tcatttatag taagtatctt agtaatgtta       240
     atgtggattc cgttaagatt aaaagttggt tttggaacaa ttctgaatgt tgttctgatc       300
     gcattatttc ttggtttaag tatattttat atttctccgc cgagttccct tttagcaagg       360
     ttttgctatc ttataacggg tattattttt tttggtatcg gaaccgcatt ttatttgact       420
     tgccatcaag gggcaggacc tcgagatgga ttaatggttg ggttatgtca tcgctttaaa       480
     ttaagaatag gaatagtccg tactcttatg gaggtttctg tttgtttttt gggttttttg       540
     ctaggcggaa cagtaggaat tggtacacta ttatttgcta ccagtattgg ttggattatt       600
     caattagggg tttattttat tatgaaactt aacaagtcgg tctaa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page