(data stored in ACNUC7421 zone)

EMBL: CP000947.PE162

CP000947.PE162       Location/Qualifiers
FT   CDS_pept        176275..177843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0164"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   hhe:HH0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31407"
FT                   /db_xref="GOA:B0UVM5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVM5"
FT                   /protein_id="ACA31407.1"
FT                   /translation="MMRLPISVTMLVKNAEKYLAKSLSSLKDFPEIIVLDNGSTDRSIE
FT                   IAKQFTNVKIYHSPFIGFGPMKNLVATYASYDWILNIDSDEILQPQLIQEISQLNFDEP
FT                   RKVYALLRINHYRGKPIKTCGWYPDFVKRLYNKKLVKFDDKRVHEALEIADDIQVVRLK
FT                   HEFNHYSFDSSEMLINKMQHYTALFAEQQKYRKKSSVLSAIAHGIVAFFKSYILKRGIL
FT                   SGGDGFIISFANASGSYYKYIKLMEANQSLTTALIITTYNRPDALEAVLVSVLAQSLLP
FT                   NEVIIADDGSTEDTKELIQKYQAIFPIPLKHVWQPDTGFRLAESRNKALSLVESEYVIT
FT                   IDGDMVLHPQFISDHRKAAEKNVFVGGGRILLTKDKTTALLQSSEQYSSFKWYEKGLET
FT                   RFEKRLMALHIPFLSEFIQRTKRVHYYNGIRGCNMAFFLSDALEINGFNNDFVGWGRED
FT                   SEFVARFFNNGGKRKNIKFAAIAYHLWHPEEDRKALPVNDELLKRAIEDKLVFCSNGLN
FT                   QIKLD"
     atgatgagat taccaatcag tgtcacaatg cttgtgaaaa atgccgagaa atatttggca        60
     aaaagcctta gttctttgaa agatttccct gaaattattg tgttagataa tggatcaaca       120
     gatcgatcta ttgaaattgc aaaacaattt actaatgtca aaatttatca ttcacctttc       180
     attggttttg gaccgatgaa aaatttagtt gcaacttatg caagttatga ttggattcta       240
     aatattgata gcgacgaaat tttacaaccc cagcttattc aagagatttc tcagcttaat       300
     ttcgatgaac cccgcaaagt ttacgcattg ttaagaatta atcattaccg tggaaagcca       360
     ataaaaactt gtggttggta tcccgacttt gtgaaacgtt tatataataa aaagttggta       420
     aaatttgatg acaagcgagt gcatgaggca ttagagattg cagatgatat acaggtagtt       480
     cgcttaaagc atgaatttaa tcattattct tttgatagta gtgagatgtt gattaataaa       540
     atgcaacatt acaccgctct ttttgcggaa caacaaaaat atagaaagaa aagtagtgta       600
     ttgtcagcaa ttgctcatgg aatagttgca tttttcaaaa gttatatatt aaagaggggg       660
     attttatcgg gaggcgatgg ttttattatt tcttttgcca acgccagcgg ttcttactat       720
     aaatatatta aattaatgga agctaatcag agtttaacaa ctgctttaat tataacaact       780
     tataatcgcc cagatgcctt agaggctgtg ttagtatccg tattagcaca gagccttttg       840
     ccgaatgaag taattatcgc tgatgacggc tcaacagaag ataccaaaga acttattcaa       900
     aaatatcaag caatttttcc tattccactt aaacatgttt ggcaaccgga tacgggcttt       960
     cgtttagctg aatctagaaa caaagcatta tctttagttg agtcagaata tgtaataacc      1020
     attgatggcg atatggtttt acatcctcaa tttatttcgg atcaccgtaa agcggcagaa      1080
     aagaatgtat ttgtgggggg gggaagaata ttgctcacta aggataaaac gaccgcactt      1140
     ttacaatcat cagaacaata ttcctctttt aaatggtatg aaaaagggct tgaaactcgt      1200
     tttgaaaaac gtttaatggc gttgcatatt cctttcttgt ctgaatttat ccaaagaact      1260
     aaaagagtgc attattataa cgggataaga gggtgtaata tggcattctt tttatctgat      1320
     gctttagaaa ttaatggttt taataatgat tttgttggtt gggggcgtga ggatagtgaa      1380
     tttgtcgctc gtttttttaa taatggagga aaaagaaaaa acatcaagtt tgcagcgatt      1440
     gcatatcact tgtggcatcc tgaagaagat agaaaagcct tgccggttaa tgatgaatta      1500
     cttaaacgag caattgaaga taaattggtt ttttgttcaa atggattgaa ccaaattaaa      1560
     ttggattaa                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page