(data stored in ACNUC7421 zone)

EMBL: CP000947.PE164

CP000947.PE164       Location/Qualifiers
FT   CDS_pept        178299..178826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0166"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: hso:HS_0294
FT                   16S rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31429"
FT                   /db_xref="GOA:B0UVM7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM7"
FT                   /protein_id="ACA31429.1"
FT                   /translation="MEQQRIEVVGKLGSTYGIRGWLRLYSSTEQAESIFDYQPWFLKIK
FT                   GQWQPIELESWKFHNHELIVKLKGINEREVAQTLANVEIGVNLSIFPLLDEGDFYWHDL
FT                   IGCQVVNLQGYAMGVVSEMMETGANDVLVVRASTKDAFGKKERLIPFLYEQVVKRVDLS
FT                   SKTIEVDWDAGF"
     atggaacaac aaagaataga agtcgttgga aaattaggtt caacatacgg aattcgtggt        60
     tggttgcgtc tttattcatc aacagaacaa gctgaaagta tctttgatta ccaaccttgg       120
     tttttaaaaa tcaaggggca atggcaacca attgaattgg aaagctggaa atttcataat       180
     cacgagttaa ttgttaaatt aaaaggcatt aatgagcgtg aggtcgcaca aactctggca       240
     aatgttgaaa tcggagtaaa tttatccatt tttcctctat tagatgaggg ggatttttat       300
     tggcatgatt taatcggttg tcaagttgtg aatctacaag gttatgcaat gggtgttgtg       360
     tctgaaatga tggaaaccgg tgccaatgat gtgttggttg tacgtgcaag tacaaaagat       420
     gcttttggta aaaaagagcg gttgattccg ttcttatatg aacaagtagt taaaagagtg       480
     gatctcagtt ctaaaactat tgaagttgac tgggatgctg gtttctaa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page