(data stored in ACNUC7421 zone)

EMBL: CP000947.PE166

CP000947.PE166       Location/Qualifiers
FT   CDS_pept        179653..180003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0168"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: hso:HS_0296 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31451"
FT                   /db_xref="GOA:B0UVM9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVM9"
FT                   /protein_id="ACA31451.1"
FT                   /translation="MSNIIKQIEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEG
FT                   VVIAIRHRGLHSAFTLRKISNGVGVERVFQTHSPIIDSITVKRKGAVRKAKLYYLRERS
FT                   GKSARIKERLGN"
     atgagtaata tcattaaaca aattgaacaa gaacaattaa aacaaaacgt acctagcttc        60
     cgtccagggg atactttaga agttaaagta tgggtagtgg aaggaagtaa acgtcgttta       120
     caagcattcg aaggtgtggt tattgcaatt cgtcaccgtg ggttacatag tgctttcact       180
     ttacgtaaaa tatctaacgg cgtaggtgtt gagcgtgtat tccaaacaca ttcaccaatt       240
     atcgacagta ttactgttaa acgtaaaggt gcggtacgta aagccaaact ttactattta       300
     cgtgagcgtt caggtaagtc tgctcgtatt aaagagcgtc ttggtaatta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page