(data stored in ACNUC7421 zone)

EMBL: CP000947.PE168

CP000947.PE168       Location/Qualifiers
FT   CDS_pept        complement(180993..181994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0170"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: hso:HS_0298
FT                   gluconate utilization operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31474"
FT                   /db_xref="GOA:B0UVN1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN1"
FT                   /protein_id="ACA31474.1"
FT                   /translation="MPDKRKRPTLQDIASHLGITKMTISRYLRDPRLVAPKTGVRIAEA
FT                   IEHFGYIPNRAPEILSNAKSKAIGVLVPSLTNHVFADVIKGIENITDQAGYQTMLAHYG
FT                   YCQEKEEKRIESLLSYNIDGLILSETEHSARTLKMLDVANIPVVEIMDTSEFGLQQVVG
FT                   FNNIAAAQSMVETMIKRGYKNIVYFSARMDKRTRLKMQGYEQAMKKHQLTPHSLLTEEP
FT                   SSFTLGAEQLKLALKKHPQIDGIFCTNDDLAIGALFECQRQGIDVPKEIGIAGFHGLNV
FT                   GLSLTTQIATVRTPRLNIGEVAAKELLNRIEGIVPENYMINLGYNIHLGESI"
     atgcccgata aacgtaaacg ccccactttg caagatattg cctctcatct tggtattact        60
     aaaatgacga taagtcgtta tttgcgtgat ccacgtcttg tcgcaccaaa aacaggtgtg       120
     cgtattgccg aagctataga acacttcgga tatattccta atcgtgcacc ggaaatttta       180
     tccaatgcga aaagcaaagc aattggtgta cttgtaccct ctttaacaaa tcatgttttt       240
     gccgatgtaa ttaaaggtat tgagaatatt accgatcaag caggttatca aaccatgtta       300
     gcccattatg gttattgtca agaaaaagaa gaaaaacgaa ttgaatcgct tctctcttat       360
     aacattgatg gacttatttt gtcggaaaca gaacattcgg caagaacgct aaaaatgtta       420
     gatgtggcaa atattcccgt tgtcgaaatt atggatacca gcgaattcgg tttacaacaa       480
     gtggtggggt tcaacaatat agcggcagca cagtctatgg tggaaacaat gattaaacga       540
     ggctataaaa atattgtcta tttctctgct cgtatggata aacgtacccg tttaaaaatg       600
     cagggttacg aacaagcaat gaaaaaacat caactgacac ctcacagtct cctcacggaa       660
     gaaccctcat catttacttt aggtgcggaa caattaaaac tggcattaaa aaaacatccc       720
     caaattgatg gcattttttg taccaatgat gatttagcaa ttggtgcgtt atttgaatgt       780
     caacgtcaag gaattgacgt acctaaagaa atcggtattg caggcttcca tgggttaaat       840
     gttggattat ctttaacgac acaaattgcc acagtacgca caccacgctt aaatatcggt       900
     gaagtggcgg caaaagaatt acttaatcgt atagaaggta ttgtacctga aaattacatg       960
     atcaatctcg gatataatat tcatttaggt gaaagtattt aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page