(data stored in ACNUC7421 zone)

EMBL: CP000947.PE169

CP000947.PE169       Location/Qualifiers
FT   CDS_pept        complement(182003..183055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0171"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   hso:HS_0299 tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31485"
FT                   /db_xref="GOA:B0UVN2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN2"
FT                   /protein_id="ACA31485.1"
FT                   /translation="MKTKKPIFQQANNEKRFTERFVSNKRYEKSTSKSPHVDNNSKRAL
FT                   SNRHSRPQNTQNTASHTHIINTTMEKPNGTGQVQVVLKRSSLVAKTEKKTGPLSPRAPE
FT                   KIKKNRAEEMKVYGENACLSLFAQRPESIVRVWTTVEMAHKVGDLFSYLASNKKVYHVV
FT                   DNSELALVSGTEHHGGICMLVKKRRPFTLHGYLDIPQQKNCLLVLNGVRNPHNIGGIIR
FT                   TCVCYGISAVVIDDVELLHSAVAMRVAEGGMEYIHPLEIDRTETALVKLRQAGYQIVHL
FT                   SSNKHAKTIKQLQLDDKVAFVLSEADTESLADKADELINLSLVNPLKHGLNVSVATGIL
FT                   LAKWTEVKLC"
     atgaagacaa aaaaaccaat ttttcaacaa gcaaataatg aaaaacgctt tactgaacgc        60
     tttgtcagca acaaaagata tgaaaaatct acatcaaaat caccgcacgt tgacaataac       120
     tcaaagcgag ctttatccaa tcggcactct cgccctcaaa atacacaaaa tacggcttcc       180
     cacactcata ttatcaatac cactatggaa aagccaaacg gtacaggaca agtacaagtt       240
     gtgctaaaac gttcaagttt agttgcaaaa actgaaaaga aaactggccc tttatcgcca       300
     cgtgcaccgg agaagatcaa gaaaaatcgt gcagaggaaa tgaaagtata tggtgaaaat       360
     gcttgtttat ccctttttgc acaacgtccg gaaagtattg tgcgtgtttg gactacggta       420
     gaaatggcac ataaagtggg ggatttgttt agctatttag ccagcaataa aaaagtctat       480
     catgtagtag ataatagcga gttagcctta gtcagcggca ctgaacatca cggcggtatt       540
     tgcatgttgg tcaaaaaacg ccgtccattt actttgcacg gctatttaga tattccacag       600
     caaaaaaact gcctattggt tttaaatggt gtgcgtaatc cacataatat tggcggaatt       660
     atccgcactt gtgtatgtta tggtataagt gcggttgtta ttgacgatgt tgaacttctt       720
     cattctgcag tagcaatgcg agtggcagaa ggcggtatgg aatatattca tccgctggaa       780
     attgatcgca ctgaaacggc attggttaaa ttgcgacaag caggctatca aatcgttcat       840
     ctaagctcaa ataaacacgc caaaaccatt aagcaattac aactcgatga taaagttgca       900
     tttgtactga gtgaagctga tactgaatca ttagcggata aagcagatga actgattaat       960
     ttgtcattag ttaatccatt aaaacacggc ttgaatgttt ctgttgcaac aggcatattg      1020
     ctggcaaaat ggacagaagt aaagttatgt tag                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page