(data stored in ACNUC7421 zone)

EMBL: CP000947.PE17

CP000947.PE17        Location/Qualifiers
FT   CDS_pept        12891..15305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0017"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: hso:HS_0151 exoribonuclease II (ribonuclease
FT                   R); TIGRFAM: VacB and RNase II family 3'-5'
FT                   exoribonuclease; ribonuclease R; PFAM: ribonuclease II; RNA
FT                   binding S1 domain protein; Ribonuclease B OB region domain;
FT                   Ribonuclease R winged-helix domain protein; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31473"
FT                   /db_xref="GOA:B0UUX5"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX5"
FT                   /protein_id="ACA31473.1"
FT                   /translation="MRTPKKTNKKAKKITALTEDPYFFQEQQKYANPIPSREFILQIIR
FT                   DFNAPMSKEDLFKTLAIVDPEQKEGMRRRLRAMENEGQLVFTKRKCYALPEKLDLLKGS
FT                   VIGHREGYGFLQIEGSKSDWFIPNIQMQKVIHGDFVLAQPNGYDRKGRSEVRIVRVLES
FT                   RNKHIVGRFFMEEGIGYVVPDDSRINRDILIPNEFRNGARMGQVVVVELKPRTATFTQL
FT                   VGKIVEILGENMAKGMETEIAIRNHDIPHIFPSAVEKQVRKYTDSVPEEAKQGRRDLRT
FT                   LPLVTIDGEDARDFDDAVFCQRSGDGGWTLWVAIADVSYYVRLRTALDNEAYQRGNSVY
FT                   FPNRVVPMLPEILSNGLCSLNPQVDRLCMVCEIRISPQGKMTDYSFYEAVMNSYARLTY
FT                   TKVAQILAGDELLQQRYHVLVPHLQELHQMYQALLQARYQRGAIDFETIETKFVFNEMG
FT                   RIECIEPMVRNDAHKIIEECMILANIAAANFMERHQEPALFRIHAGPSQEKLSAFRAFL
FT                   RECGLTLKGGINPTTADYAQLLAQVRERPDHELIQTMLLRSLSQAVYHPDNIGHFGLAL
FT                   TEYAHFTSPIRRYPDLTLHRSIKYLLAKQQGSKRKTTDTGGYHYSLEEMDLLGDHCSLT
FT                   ERRADDATREVADWLKCEYMQDHVGDEFDGIISSVTGFGLFVRLDDLFIDGLVHISTLD
FT                   NDYYQFDSIKQRLIGENSGTTYRLGDKVKIRVEAVSLAQRQVDFVLLSSQRKPRRSGKT
FT                   ANKRAKQKSFQEKNRTSKIERHKSAVKITKKLSKKQQSPASKTRKQKKQKG"
     atgagaaccc cgaaaaagac aaacaaaaaa gcgaaaaaaa tcaccgcact tacagaagat        60
     ccgtattttt tccaagagca acagaaatat gctaatccaa tcccgagtcg agagtttatt       120
     ttacaaatta ttcgtgattt taatgcacct atgtcgaaag aagatctgtt caagacattg       180
     gctatcgttg atcctgaaca aaaagaggga atgcgtcgcc gtttgcgtgc aatggaaaat       240
     gaagggcaat tggtctttac taaaagaaag tgttacgcct tgcctgaaaa attggattta       300
     ttaaaggggt cagtgattgg tcatcgtgaa ggctatggtt ttttacaaat cgaaggaagc       360
     aagtcagatt ggtttattcc aaatattcaa atgcaaaaag ttatccatgg tgattttgta       420
     ttggcacaac ctaatggcta tgaccgtaaa ggacgttcag aggtgcgtat tgttcgagtg       480
     ttagaaagtc gcaataaaca tattgttggg cgttttttca tggaggaggg gattggttat       540
     gtcgtgccgg atgatagccg tattaatcgt gacattctga ttccgaatga gtttcgcaac       600
     ggagcgagaa tgggacaggt agttgtggtt gaacttaaac ctcgtacagc aacatttacg       660
     cagttggttg gaaaaattgt agaaattctt ggggagaata tggcaaaggg aatggaaact       720
     gaaattgcta ttcgcaatca tgatattcct catatttttc caagtgcggt agaaaaacaa       780
     gtaagaaaat atacggatag tgtgccggag gaagcaaaac aaggacgaag agatttaaga       840
     accttaccat tggtaaccat tgatggtgaa gatgcacgag attttgatga tgcggttttt       900
     tgtcaaagaa gtggtgatgg cgggtggaca ttatgggttg ccattgccga cgtgagctat       960
     tacgtacgtt tgcgtactgc attagataac gaagcatatc agcgtggcaa ttcggtttac      1020
     tttcctaacc gagttgtacc aatgttgccg gagattttat cgaatggatt atgttcgctt      1080
     aatccacagg ttgatcgttt gtgtatggta tgtgagatac gaatttcgcc acagggaaaa      1140
     atgactgatt acagttttta tgaagcggtc atgaactcat atgcaagatt aacttacact      1200
     aaagttgcac aaattttggc aggtgatgaa ttattacaac aacgctatca tgttttagta      1260
     ccgcacttac aagaattgca ccaaatgtat caggctctgc tgcaagctcg ttatcagcgt      1320
     ggagccattg attttgaaac tattgaaact aagtttgtct tcaatgaaat gggacgtatt      1380
     gaatgtattg aacctatggt gcgtaacgat gcccataaaa tcattgaaga atgtatgatt      1440
     ttagcaaata ttgcagcagc taattttatg gaacgtcatc aagaacccgc tttatttcgt      1500
     attcatgccg gaccaagtca agaaaaactc agtgcatttc gtgcttttct acgtgaatgt      1560
     ggcttaacgt taaaaggtgg tataaacccc acaaccgcag attacgcaca gttgttagcc      1620
     caagttcgtg aacgtccgga tcatgaatta attcaaacta tgctacttcg ttcacttagc      1680
     caagctgttt atcaccctga taatattgga cattttggtt tagcactaac ggaatatgca      1740
     cattttactt cgcctattcg ccgttatcct gatttaacgt tacatcgtag tatcaaatat      1800
     ttattagcaa aacagcaagg ttctaaaaga aaaacaaccg ataccggcgg ttatcattat      1860
     tccctagaag aaatggatct tctcggtgat cattgttctt taaccgaacg ccgagctgat      1920
     gatgcaacaa gagaagtggc agattggcta aaatgcgaat atatgcaaga tcatgttgga      1980
     gatgaatttg acggtattat ttcttccgta accggttttg ggttgtttgt gcgtttagat      2040
     gatttattta ttgatgggct agttcatatt tcaaccttag ataatgatta ttatcaattt      2100
     gactcaataa aacaacgttt aattggggaa aattccggta cgacttatcg tctcggtgat      2160
     aaagttaaaa tccgtgttga ggcagtcagt ttagctcaac gccaagtgga ttttgtttta      2220
     ttatcgagtc agcgtaaacc tagacgttcc ggcaaaacgg cgaataagcg agcgaaacaa      2280
     aaaagcttcc aagaaaagaa ccgcacttct aagatcgagc gacataaaag tgcggtaaaa      2340
     ataacaaaaa aattatcaaa aaaacaacaa agtccggcaa gtaaaacaag aaaacagaaa      2400
     aaacagaaag gataa                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page