(data stored in ACNUC7421 zone)

EMBL: CP000947.PE171

CP000947.PE171       Location/Qualifiers
FT   CDS_pept        complement(184618..185328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0173"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: hso:HS_0301 DNA polymerase III,
FT                   epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31507"
FT                   /db_xref="GOA:B0UVN4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN4"
FT                   /protein_id="ACA31507.1"
FT                   /translation="MIKNFLNKFHPLNKLEKQRKIFINQDNLPVQWKRLFEKPYPKSST
FT                   DLTALSYLVIDFETTGLNSMMDNILSVATVPIDNLTLDISKAWHQFVAEQQEIKEDTVI
FT                   INHILPQMLNGAETLDDTMNKLFELMQGRILIAHGSTIEKRFILHYLNVRYNLSQFPLF
FT                   WLDTLKIERSLCQDNENNYQLSHIRNKYNLPEYIGHNALIDAISAGELFLAQLEKVFGK
FT                   SSKEIGEIYRRSIG"
     atgataaaaa atttcctcaa caaatttcat ccgttgaata aattggaaaa acagcgaaaa        60
     atctttatta atcaagataa tttacccgtg caatggaaaa ggttatttga aaagccttac       120
     cccaaaagtt ccacagattt gaccgcactt tcctacttag taattgattt cgaaaccaca       180
     gggctgaatt caatgatgga taatattttg agtgttgcta ccgttcccat tgacaattta       240
     acattagata tttcaaaagc atggcatcaa ttcgtcgccg agcaacaaga aattaaagaa       300
     gatactgtta ttatcaatca tattttgcca caaatgctaa atggggcaga aaccttagat       360
     gatacaatga ataaactctt tgagctgatg caaggacgta ttcttattgc tcacggctcc       420
     actatagaaa agcgttttat cttacattat ctgaacgttc gctataattt atcgcaattt       480
     cctctgtttt ggttagatac cttaaaaatt gaacgttcgt tatgtcagga caacgaaaat       540
     aattatcaac ttagccatat tcgtaataaa tataatttgc ccgaatatat cggtcataat       600
     gcacttattg atgcaatatc tgccggtgag ctttttttgg cacaattaga aaaggtgttt       660
     ggtaagagtt caaaagaaat cggcgaaatt tatcgccgat ctatcggtta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page