(data stored in ACNUC7421 zone)

EMBL: CP000947.PE172

CP000947.PE172       Location/Qualifiers
FT   CDS_pept        complement(185325..187205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0174"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: hso:HS_0302 possible
FT                   signal-transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31518"
FT                   /db_xref="GOA:B0UVN5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN5"
FT                   /protein_id="ACA31518.1"
FT                   /translation="MDSSLIPNIELFIAQVPPFTHLPHDLIRLTAQNIEIRYIPKGELI
FT                   TNDEIDSLNNNENLYIVRMGSVEQVNKSGQLRARLESGDCFGFSIFNHHEQDKYQAYAL
FT                   ENTLIYQIPFQRLNELLKKFPEYASYFSSDAGKRLNSLAKNNFLKNQNDIFMKKVIDIA
FT                   NPKIALVDTNTTLQQAAIRMCEQRRSSALVMQQNKLIGIIHDRDMTKKVVAQGLDVNTL
FT                   VTEIMNINPPVIRGDELVLQAISMMMQHNIRSLPVIVDDKVQGILTATDLVKQNSMQSV
FT                   FIINRIFQANTLPLLVEIAKQQRDLFRALLERGVAYNNIMHVMTLIADAFARKLLMMAE
FT                   HKLGTPPCRYAWVVAGSQARYEMHPLSDQDNAIILERKLTALEQEYFVQLTKFVNNGLH
FT                   ECGYPYCTGNYMAINARWCVSLQEWKENFRSWIIAPELEGLLNASVFMDMRGIYGDLNL
FT                   ADQLQQYFVDLVAHNKRFLAFLVANSIRVKPPLSIFRNFVLIKEGEHKNKLNLKKRAIS
FT                   LLVDLARIYALAAGLAQTMSTEQRFRHCYKQGILNKETLNNALEVYQFVCNMRFKYQSD
FT                   ALQQQQELTNHIDPSELSALERNHLKDAFRLIAQFQEAAEIRFSQRGIMR"
     atggatagct cacttattcc caatatcgaa ttatttattg cacaggttcc cccttttaca        60
     catttacctc atgatttaat tcgtcttact gcacagaata ttgaaattcg ttatatcccc       120
     aaaggggaac taatcacaaa tgatgaaatc gatagcctca ataataatga aaacttgtat       180
     attgtgcgta tgggatcagt ggagcaagtc aataaatcag gacaattaag agcaagattg       240
     gaaagtggcg attgttttgg tttcagtatt ttcaatcatc acgagcaaga taaatatcag       300
     gcttatgcgt tggaaaatac gttaatttat caaattcctt ttcaacgctt aaatgaactt       360
     ttaaaaaaat ttcctgagta cgcttcttac ttttcttctg atgcaggaaa aagactaaac       420
     agtttggcaa aaaataactt tttaaaaaat caaaatgata ttttcatgaa aaaagtgatt       480
     gatattgcta atcctaaaat tgctcttgtt gatacgaata cgacattaca acaagctgcg       540
     attagaatgt gtgaacaacg ccgttcttct gctttagtga tgcaacaaaa caaattgatt       600
     ggcattattc atgatcggga tatgaccaaa aaagttgtag cacaaggctt agatgtaaat       660
     acgttagtga cagaaatcat gaacattaat cctcctgtga ttaggggtga tgaattagta       720
     ctacaagcta tttccatgat gatgcaacat aatattcgta gcttgccggt gattgttgat       780
     gataaagttc aaggtatttt aaccgccaca gatcttgtaa aacaaaacag tatgcaatct       840
     gtttttatca ttaaccgtat ttttcaagca aatacgctgc ctttgcttgt agaaatagct       900
     aaacagcaac gggatttatt ccgtgcttta ctagagagag gtgtcgctta taataatatt       960
     atgcacgtga tgacgcttat cgctgatgca tttgcccgta agttgctcat gatggcggaa      1020
     cataaattag gaactccgcc ttgtcgctat gcttgggttg tagcaggttc acaggctcgt      1080
     tatgaaatgc accctttatc agatcaggat aatgcaatca ttttagaaag aaaattaacc      1140
     gcacttgaac aggagtattt tgtacaacta actaaatttg taaacaatgg attgcatgaa      1200
     tgcggctatc cttactgcac gggtaactat atggcaataa atgcacgctg gtgtgtttct      1260
     ctacaggaat ggaaagaaaa tttccgtagt tggattattg cacctgaatt agaaggtttg      1320
     ctcaatgcct ctgtatttat ggatatgcga ggtatttacg gtgatcttaa tttggcagat      1380
     caacttcagc aatattttgt cgatttagtc gcacacaata aacgcttttt agcgttctta      1440
     gtggcaaaca gtattcgagt aaaaccccca ttaagtattt tccgaaattt tgttcttatt      1500
     aaagaaggtg aacataaaaa taaacttaac ttgaaaaaac gtgctatcag tttattagta      1560
     gatcttgcac gaatttacgc acttgctgcc ggtttagcac aaactatgtc aactgaacag      1620
     cgttttagac attgttacaa gcaaggtatt ctgaataaag aaacccttaa taatgcactg      1680
     gaggtatatc aatttgtctg caatatgcgt tttaaatatc aatcagacgc cttgcaacaa      1740
     cagcaagaac taactaatca tatcgatccc agtgagttaa gtgcccttga acgaaatcac      1800
     cttaaagatg cttttcgctt aattgcccaa tttcaagagg cggcagagat acgtttttca      1860
     caacgaggaa taatgagatg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page