(data stored in ACNUC7421 zone)

EMBL: CP000947.PE173

CP000947.PE173       Location/Qualifiers
FT   CDS_pept        complement(187307..189217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0175"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hso:HS_0303
FT                   myo-inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31529"
FT                   /db_xref="GOA:B0UVN6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018659"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN6"
FT                   /protein_id="ACA31529.1"
FT                   /translation="MKKEKTLDLICLGRVAVDLYAQQIGSRLEDVSSFAKYLGGSSGNV
FT                   AYGTAVQGVKSSMLARVGDEHMGRFLREELQRLGVDTSHLITDKERLTALVILGIKDQD
FT                   TFPLIFYRDNCADMAITADDFDEEYIASAKALAITGTHLSHPKTRHAVLTALEYAGRNG
FT                   TKRLLDIDYRPVLWGLTSLGDGETRFIDSEAVTQSLQEVLHHFDVLVGTEEEFHIAGGS
FT                   TDTLTALKNVRKVSNATLVCKRGALGCSVFEGDIPNHIDGGINVYGVRVEVLNVLGAGD
FT                   AFMSGLLRGYINGESWEQCCRYANACGALVVSRHGCAPAMPTKEELDNYLSRAESVPRP
FT                   DLDEQLNHLHRVTTRKQQWHDLCIFAFDHRKQLVDMAEKCGADLKRIPTLKTLLLKAAE
FT                   QTAQKEGIYNGNAGVLADTTFGQEALNEITGKKWWIGRPIEMPSSRPLRLEHGDLGSQL
FT                   ISWPAEHVVKCLAFYHPADKAELKADQDATLKEVYRACCRTGHELLLEIILPADMEQKE
FT                   SYYTDMIAHFYSLGIKPDWWKLPGVSAKTWADISQVIEKNDKHCRGILILGLDAPEAVF
FT                   ENVFKASANAPLVKGFAVGRTIFGQPSADWLAGKIDDEQLIKETSERYRRLIKLWKNRK
FT                   N"
     atgaaaaaag aaaaaacatt agatcttatt tgtcttggac gagttgccgt agatttatat        60
     gctcaacaaa tcggttcacg cttagaggat gtgagctctt ttgctaaata tctcggcgga       120
     tcatcaggta atgttgctta tgggacagct gtacaaggtg taaaatcatc tatgttggct       180
     cgtgtaggtg atgaacatat gggacgtttc ttacgtgagg aattgcagcg tctaggtgta       240
     gatacgagcc atttgattac ggataaagag cggctgactg ctctagtgat tttaggaata       300
     aaagatcaag atacttttcc attaattttc tatcgtgata attgtgcaga catggcaatc       360
     accgctgatg attttgatga agaatatatt gcttcggcga aagcacttgc tattaccgga       420
     acgcatttat cccatccaaa aactcgccat gcggttttaa ccgcacttga atacgcaggt       480
     cgtaatggaa caaaacgttt actggatatt gactatcgtc ctgtactttg gggattaact       540
     tcattgggtg atggtgaaac tcgttttatt gactctgaag ccgttacaca atctttacaa       600
     gaagttttac atcactttga tgtcttagtt ggtacagaag aggagtttca tattgccgga       660
     ggctcaactg atacgctaac tgcattaaaa aatgtacgta aagtcagtaa cgctacgtta       720
     gtttgcaaac gtggggcgtt aggttgttct gtctttgagg gcgatattcc gaatcatatt       780
     gacggtggta ttaatgtata tggcgtacgt gttgaagttt tgaatgtctt aggtgcaggc       840
     gatgccttta tgtcaggttt attacgtggc tatattaacg gtgaaagttg ggagcaatgt       900
     tgtcgttatg caaatgcttg cggtgcgttg gtcgtctctc gccatggttg tgccccggca       960
     atgccgacta aagaagaatt agataattat ctctcccgtg cggaatcggt acctcgaccg      1020
     gacttagacg aacaattaaa ccatttacac cgtgttacaa cacgcaagca acaatggcat      1080
     gatttatgta tttttgcctt tgatcatcgt aaacaattgg ttgatatggc tgaaaagtgc      1140
     ggtgcagatt tgaaacgtat tccaacactc aaaacgttat tacttaaagc cgcagaacaa      1200
     accgctcaaa aagaggggat ttataatggc aatgccggcg ttttagctga taccacattt      1260
     ggtcaagaag cactcaatga aattactggt aaaaaatggt ggattggtcg tccaatagaa      1320
     atgccatctt ctcgtccatt gcgtttagag catggtgatt taggtagtca actcattagt      1380
     tggcccgcag aacatgtcgt taaatgttta gcgttctatc atccagcaga caaggcagag      1440
     ttaaaagcag atcaagatgc aacattaaaa gaagtttatc gtgcttgttg tcgtacaggt      1500
     cacgaattat tactagagat cattttgcct gcggatatgg agcaaaaaga aagttactac      1560
     accgatatga ttgcccactt ctattctctc ggcattaaac cggattggtg gaaattacct      1620
     ggagtgtccg caaaaacttg ggcagacatc agtcaagtca ttgaaaaaaa tgacaaacat      1680
     tgtcgtggta ttttaatcct tggcttagac gcacctgaag cagtctttga gaatgtgttt      1740
     aaagcatcgg caaacgcacc tttagtaaaa gggtttgctg taggcagaac aatttttgga      1800
     caaccttcgg ctgattggtt agctggtaaa attgatgatg agcaactcat caaagaaacc      1860
     tcagagcgtt atagaagatt aattaaatta tggaaaaatc gtaaaaacta a               1911
//

If you have problems or comments...

PBIL Back to PBIL home page