(data stored in ACNUC7421 zone)

EMBL: CP000947.PE174

CP000947.PE174       Location/Qualifiers
FT   CDS_pept        189460..190302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0176"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: hso:HS_0304 possible transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31540"
FT                   /db_xref="GOA:B0UVN7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVN7"
FT                   /protein_id="ACA31540.1"
FT                   /translation="MQEHSQLVTLQNEIRSRYSTLSKRLKQVAQYVLDNHNSVIFDTVA
FT                   TISERAGVPPSTLIRFANAFGFSGFNEMKQIFRENLIEETANYTERLQVFRQLEPEKSE
FT                   QHNLQDILNIFAQANNQALKQLSSQTTTKQLKSAVEILKNAQNIFIIGLKRSFSIACYL
FT                   DYVLHHLDCRSFLINGLGGMFDEQLMQVKKGDVIVAVSFSPYAKETLEIVSATSQKGVK
FT                   HIAITDSQISPLIASSDVAFVVKEAQVSGFRSQCATMTLVQTLAILLGLEKEKETQNS"
     atgcaagaac attctcaact cgttacatta caaaatgaaa tccgttcacg ttattcgact        60
     ttgagtaaac gtttgaaaca ggtagcacaa tatgtccttg ataatcacaa tagcgtaatt       120
     tttgatactg ttgcgacgat atctgaacgt gccggtgttc ctccttctac gcttattcgc       180
     ttcgcaaatg cgtttgggtt tagtggcttt aatgaaatga aacaaatttt tcgtgaaaat       240
     ttgattgaag aaacggcgaa ttatacggag cgtttacaag ttttccgtca gctggaaccg       300
     gaaaagagcg agcaacataa tctgcaagat attttgaata tttttgcaca agccaataat       360
     caagcactaa aacaattaag tagccaaact actacaaaac agttaaaaag tgcggtagaa       420
     atattaaaaa atgcacagaa tatttttatc attggattaa aacgttcgtt tagtattgcc       480
     tgttatttgg attatgtgtt gcatcattta gattgccgtt cttttttaat aaatggatta       540
     ggcggtatgt ttgatgaaca attaatgcaa gtgaaaaagg gtgatgtcat cgtggcggtg       600
     agtttttcac cttatgccaa agaaacgctg gaaattgtta gtgcaacctc acaaaaaggt       660
     gtcaaacata ttgctatcac tgatagtcaa attagtccat taattgcctc cagcgatgtt       720
     gcttttgtcg tgaaagaagc acaggtaagc ggcttccgtt cacaatgtgc tacgatgaca       780
     ttggtacaaa ctttggcgat tttattaggc ttagaaaaag agaaagaaac acaaaattct       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page