(data stored in ACNUC7421 zone)

EMBL: CP000947.PE175

CP000947.PE175       Location/Qualifiers
FT   CDS_pept        complement(190339..191103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0177"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   hso:HS_0305 possible SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31551"
FT                   /db_xref="GOA:B0UVN8"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVN8"
FT                   /protein_id="ACA31551.1"
FT                   /translation="MVNQKIQLICETESAVQFTALCQQKGLIHDPNSYLALVQTKVEGQ
FT                   VRLELRKLDEPKLGAVYVDFVTGTMAHRRKFGGGRAEAVAKAVGIKGNYLPTVIDATAG
FT                   LGRDAFVLAALGCKVRLVERHPVVHLLLQDGLKRAYADAEIGTMMQANMQLLDIAHIQE
FT                   LNSSEEGADVVYLDPMYPHKQKSALVKKEMRIFQHLIGADLDADMLLEPALLLAQKRAV
FT                   VKRPDYADFLAKKTPHFSHQTKNHRFDIYLKT"
     atggttaatc aaaaaatcca attaatttgt gaaacagaaa gtgcggtgca atttaccgca        60
     ctttgtcaac aaaaaggttt gattcacgat cctaatagtt atttagcact ggtgcaaaca       120
     aaagtggaag gacaggttcg cttggaatta cgcaaattag atgagccgaa acttggtgct       180
     gtttatgtgg attttgtgac cggcacaatg gctcaccgtc gtaaatttgg aggcggtcga       240
     gctgaagctg tggcaaaagc ggtagggatc aaaggtaatt atctgccgac agttattgat       300
     gcaactgccg gtttgggacg tgacgccttt gtgctggctg ctttggggtg taaagtccgt       360
     ttggttgaac gccatccggt agtccatttg ttattacaag acggcttgaa gcgtgcttat       420
     gccgatgcgg aaatagggac tatgatgcag gcgaatatgc aattgctgga catagcacat       480
     attcaagaat taaattcgag tgaagaaggt gctgatgttg tctacttgga tccgatgtat       540
     cctcataaac aaaaaagtgc attggttaaa aaagaaatgc gtatttttca acatttaatc       600
     ggtgcagatt tggatgctga tatgttatta gaacctgcct tattgctcgc acaaaaaaga       660
     gcggtagtaa agcgtcccga ttacgcagat tttcttgcta aaaaaacacc gcacttcagt       720
     caccaaacca aaaatcatcg ttttgatatt tatctcaaaa cttag                       765
//

If you have problems or comments...

PBIL Back to PBIL home page