(data stored in ACNUC7421 zone)

EMBL: CP000947.PE177

CP000947.PE177       Location/Qualifiers
FT   CDS_pept        complement(192245..192574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0179"
FT                   /product="protein of unknown function DUF413"
FT                   /note="PFAM: protein of unknown function DUF413; KEGG:
FT                   hso:HS_0307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31573"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP0"
FT                   /protein_id="ACA31573.1"
FT                   /translation="MAESFSVTRRFFDDKNYPRGFARHGDYTIRESQTLEQYGQAFKAL
FT                   DLGERVPVTEEEKAFVAFCRGERPAETYFEKTWNKYRTRISASKRVYTLSGVVGADNPD
FT                   DFSAE"
     atggcagaga gttttagtgt tacacgtcgt tttttcgatg ataaaaatta tccacgaggt        60
     tttgctcgtc atggtgatta caccattcgt gaatctcaaa cgttagagca atatggtcaa       120
     gcatttaaag cgttagattt aggtgagcgt gtaccagtta cggaagaaga aaaagctttc       180
     gttgctttct gtcgtggaga acgtccagca gaaacatatt ttgagaaaac ttggaataaa       240
     taccgcactc gtatttctgc cagtaaacgt gtttacacat tatctggcgt tgttggtgct       300
     gacaatccgg atgatttctc tgccgaataa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page