(data stored in ACNUC7421 zone)

EMBL: CP000947.PE178

CP000947.PE178       Location/Qualifiers
FT   CDS_pept        complement(192628..193236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0180"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: hso:HS_0308 protein
FT                   disulfide-isomerase (thiol:disulfide interchange protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31585"
FT                   /db_xref="GOA:B0UVP1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP1"
FT                   /protein_id="ACA31585.1"
FT                   /translation="MKKFLWALASFFFLNSTQALALQEGKQYIELEQPRSVQPEVIEFF
FT                   SFGCIHCFNFEKTYQIPQQIKADLPKDVTFKQYHVDWMGEDIVRAWSLAILLGIEEKVK
FT                   MPLFELIIEKRKAPTLDNIREVFLANGITAAQFDGGINSFAVTAQTNKQIALAKKLGVR
FT                   ATPEFYINGKYKVNAEGLSRTTDGFIKDYVETVKGLLQK"
     atgaaaaaat ttctatgggc attagcctct tttttctttt taaattcaac tcaagcctta        60
     gcattacaag aaggaaaaca gtatattgaa ctagagcagc ctcgttccgt tcaacctgaa       120
     gtgattgaat ttttctcttt tggttgtatc cattgtttta attttgaaaa aacatatcaa       180
     attccacaac aaattaaagc tgatttgccc aaagatgtca ctttcaaaca atatcatgtt       240
     gattggatgg gcgaagatat tgttcgtgct tggtcgttag caattctctt aggtatagaa       300
     gaaaaagtta aaatgcctct atttgaattg attattgaaa aaagaaaagc acctacttta       360
     gacaatattc gtgaagtgtt tctcgcaaac ggcattactg cggcacagtt tgacggagga       420
     attaatagtt ttgccgtcac cgctcaaaca aacaaacaaa ttgccttagc aaaaaaactt       480
     ggcgtaagag caacacctga attttatatt aacggtaaat ataaagtaaa tgcggaaggt       540
     ctatcccgta caacagacgg ttttatcaag gattatgtag aaactgttaa aggtttattg       600
     caaaaataa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page