(data stored in ACNUC7421 zone)

EMBL: CP000947.PE179

CP000947.PE179       Location/Qualifiers
FT   CDS_pept        complement(193246..193512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0181"
FT                   /product="protein of unknown function DUF1040"
FT                   /note="PFAM: protein of unknown function DUF1040; KEGG:
FT                   hso:HS_0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31596"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP2"
FT                   /protein_id="ACA31596.1"
FT                   /translation="MKCHRLNEVLELLQPYWSNNPDLHLIQVLQKIAEETGFDKPIAEL
FT                   TDEVIIYHLKMYGTGKNEPIPGIKKDYEDDFKTALLKARGIID"
     atgaaatgtc atcgtttaaa cgaagtgttg gaacttttac agccctattg gtctaacaat        60
     ccggatttac atttaatcca agttttacaa aaaattgcgg aggaaaccgg ttttgataag       120
     cccattgcgg aattaaccga tgaggttatt atttatcacc taaaaatgta tggtacaggt       180
     aaaaatgagc ctattcccgg catcaaaaaa gattatgaag acgattttaa aacagcctta       240
     ttaaaagcac gtggcattat tgattag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page