(data stored in ACNUC7421 zone)

EMBL: CP000947.PE18

CP000947.PE18        Location/Qualifiers
FT   CDS_pept        15312..16049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0018"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: hso:HS_0152
FT                   tRNA/rRNA methyltransferase, SpoU family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31584"
FT                   /db_xref="GOA:B0UUX6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX6"
FT                   /protein_id="ACA31584.1"
FT                   /translation="MAENIYGIHAVQAFLINAPERLIEVYVLKGREDKRLQSVLNELYK
FT                   LGISVQFLNRDTLDKKANGEVHQGIIARVQPAKELNENDLVEILQKKANPLLLVLDGIT
FT                   DPHNLGACLRSADAAGVCAVIVPKDKSAQLTAIARKVACGAAEVVPLVRVTNLARTLRD
FT                   LQQQHNIWVVGTAGEAIETLYEAKLTGGLALVMGAEGDGMRRLTRETCDQLISIPMAGS
FT                   VSSLNVSVATGICLFEIVRQRLG"
     atggcagaaa atatttatgg aattcatgcg gtgcaggctt ttcttattaa tgcaccagaa        60
     cgtttgatcg aagtttatgt gctaaaaggg cgggaagata agcggttaca atccgtactg       120
     aatgagcttt ataaattagg tataagcgta caatttttga atcgtgatac attggataaa       180
     aaagcgaacg gagaagtaca tcaaggtatc attgctcgtg ttcaaccagc taaagagttg       240
     aatgaaaatg acttggttga gatcttacaa aaaaaagcaa atccattatt gctggtattg       300
     gatggtatca cagatccgca taatttaggt gcttgtttac gatcagcaga tgctgccggt       360
     gtttgtgctg tgattgtgcc aaaagataaa tcggcacaat tgactgcgat tgctcgtaaa       420
     gtcgcttgtg gagcggcgga agttgttcct cttgttcgtg taacaaattt agcccgcact       480
     ttacgagatc tacagcaaca acataatatt tgggttgtag gtacggctgg cgaggcgatt       540
     gaaactttat acgaagcgaa attaaccggc ggtttagcac ttgttatggg ggctgaggga       600
     gatggaatgc gtcgtttaac ccgtgaaact tgcgatcaat tgattagcat tcctatggcg       660
     ggttccgtat cttcattaaa tgtttctgtt gccacaggca tttgtctatt tgaaattgtg       720
     cgacaaagat taggataa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page