(data stored in ACNUC7421 zone)

EMBL: CP000947.PE181

CP000947.PE181       Location/Qualifiers
FT   CDS_pept        194285..196291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0183"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="TIGRFAM: oligopeptide transporters, OPT superfamily;
FT                   oligopeptide transporter, OPT family; PFAM: Oligopeptide
FT                   transporter OPT superfamily protein; KEGG: hso:HS_0311
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31616"
FT                   /db_xref="GOA:B0UVP4"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP4"
FT                   /protein_id="ACA31616.1"
FT                   /translation="MLSKQQSLKELTFRGMLLGALITVVFTASNVYLGLKVGLTFASSV
FT                   PAAVISMAVLKFFKGSNILENNMVQTQASSAGTLSSVIFVIPAMLMLGYWQGFPFWQTL
FT                   LICISGGMLGVIFTVPLRNVMVVKSDLPYPEGVAAAEVLKAGNDEIGGRGVKELTIGGL
FT                   IAAVAGFLTNGLRVIADSASLWFKGGNAIFQVPMGFSLALLGAGYLVGMIGGLAILLGI
FT                   FVAWGVAVPYFTSVAPMPSDADMIGYAFSIWKNKVRFIGVGTIGIAAIWTLLVLMKPMI
FT                   QGMIESFRALKDPNAKNTDRTSQDLSPTTLIFTTLVSVVLIVLALYSFINPVGIEAGTA
FT                   IILILVCTLLAVVIGFLVAAACGYMAGLVGSSSSPISGIGIISVVTTSLVLMLVGSATG
FT                   LLDTAEGQKFLTALTLFTGSIVVCIAAISNDNLQDLKTGQLVEATPWRQQFALIIGVIV
FT                   GALVIAPVLEILYHAYGFAGAMPRETMDPSQALFAPQATLMMTIANGIFSHNLEWNYIF
FT                   FGIGFGAVLIFIDSVLKKASNKRLALPALAVGMGIYLPPSVNAPIVVGALLAWLINRHL
FT                   ENFAKRTGKDLADVKKKAERFGTLFAAGLIVGESLIGILLAFIVAGSVTSGGSDAPLAL
FT                   HLENWESLAQVLGLMMFATGITIFALRVLKAKQ"
     atgttaagca aacaacaatc attaaaagaa ctcacatttc gaggaatgtt attgggggcg        60
     ttgatcactg tggtatttac ggcttccaat gtgtatttgg gtttaaaagt cgggttgact       120
     tttgcctcat cagttcctgc agcggttatc tcaatggcag tattaaaatt tttcaagggg       180
     tctaatattc ttgaaaataa tatggtacaa actcaagcat cctcagccgg aacattgtct       240
     tccgttattt ttgttatccc tgctatgttg atgctgggat attggcaagg tttccctttt       300
     tggcaaacat tattaatttg tatttccggc ggtatgctag gggtaatttt cactgtgccg       360
     ttgcgtaatg tcatggtagt gaaaagtgat ttgccttacc ctgaaggcgt tgccgcagca       420
     gaagtattga aagcgggtaa tgatgaaatc ggtggaagag gtgtcaaaga acttacaatc       480
     ggtggtctga ttgcagcggt agccgggttt ttaactaatg gtttacgtgt aattgcggat       540
     agtgcaagtc tttggttcaa aggtggaaat gcaatttttc aagtgccgat gggtttctca       600
     cttgctctgt taggtgcggg gtatttagtg ggtatgattg gcggtttagc cattttatta       660
     ggcatttttg ttgcttgggg agtagcagtt ccttacttta cttctgtcgc acccatgccg       720
     tctgatgccg atatgatagg ttatgctttc agtatttgga aaaataaagt gcgttttatt       780
     ggtgtaggga ctatcggtat tgcggcaatt tggactttat tggtgttaat gaaaccaatg       840
     attcaaggta tgatcgagtc atttagagct ttgaaagatc cgaatgcaaa aaatactgac       900
     cgcacttccc aagacttatc tccgacaacg ctgattttca ccacgttagt aagcgttgta       960
     ttaattgtat tggctttata tagctttata aatcctgtgg gtattgaagc cggcacggcg      1020
     atcattttaa ttttggtttg cactttactt gctgtcgtta tcggtttctt agtagcagca      1080
     gcgtgcggat atatggcagg ccttgttggt tcatcatcaa gcccaatttc cggaatcggt      1140
     attatttctg tggtaacaac ttcattagtg ttaatgctcg tcggttctgc tacaggttta      1200
     ttagacacgg cggaaggtca gaaatttttg accgcactta cgctatttac cggttcaatc      1260
     gtggtttgta ttgcggcaat ttctaatgat aacttacaag atttaaaaac cggtcaattg      1320
     gttgaagcaa caccttggcg tcaacagttt gccttgatta tcggtgtgat tgtgggggcg      1380
     ttggttattg ctcctgtatt ggaaattctt tatcacgcct atggttttgc cggtgcaatg      1440
     cctcgtgaaa ctatggatcc gagccaagca cttttcgcac cgcaagcaac cttaatgatg      1500
     actatcgcaa acggtatttt ttctcataat ctcgaatgga actatatttt ctttggtatc      1560
     ggctttggtg cggttttaat tttcatcgac agcgtattga aaaaggcgtc taacaaacgt      1620
     ttagcgttac cagcattggc agtaggaatg gggatctact taccgccgtc agtcaatgca      1680
     ccaatcgttg tcggtgcatt gcttgcttgg ttgattaatc gtcatttaga aaactttgcg      1740
     aaacgtacag gcaaagatct tgctgatgtg aagaaaaaag cggaacgttt cggcacatta      1800
     tttgcagcgg gtctgattgt gggtgaaagt ttaatcggga tattactggc atttattgtt      1860
     gcaggttccg ttacttccgg aggttctgat gcaccgctag cattacattt agaaaactgg      1920
     gagagtctag ctcaagtatt aggcttaatg atgttcgcta cgggtataac aatctttgca      1980
     ttacgtgtac tcaaggcgaa acaataa                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page