(data stored in ACNUC7421 zone)

EMBL: CP000947.PE182

CP000947.PE182       Location/Qualifiers
FT   CDS_pept        complement(196413..197171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0184"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hso:HS_0313 conserved hypothetical protein, with TPR
FT                   repeat (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31627"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP5"
FT                   /protein_id="ACA31627.1"
FT                   /translation="MNLKKSLLIALLSFGVAQSALAETNSEKLDRATQLYKQQNYSAAF
FT                   PLLKQLGEKGNAKAQAVLGTMYMFGQGITQNSQQAVYWYTKAAEQGDAKAQSMLGFMYT
FT                   NGLGVTQNSQQAVYWWTKAAEQGAAEVQLYLGVMYANGQGVAQNYQQAVYWFTKAAEQG
FT                   IAEAQLYLGVMYANGQGVAQNYQQAVYWFTKAAEQGIAEAQLYLGDMYEKGRGAQKNVS
FT                   TAKAFYGQACDNGNAQGCKDFARLDKQGVR"
     atgaacctaa aaaaatccct acttatcgcc ttgctctctt tcggtgttgc ccaatctgca        60
     cttgccgaaa ccaatagcga aaaacttgac cgagctactc aactttacaa acaacaaaat       120
     tattctgccg cttttccctt actcaaacaa ctgggggaaa aaggaaatgc aaaagcacaa       180
     gctgtgctcg gcacaatgta tatgtttgga cagggtatta cacaaaactc tcaacaagcc       240
     gtctattggt acacaaaagc cgctgaacag ggagatgcaa aagcacaatc tatgctcggc       300
     tttatgtaca cgaacggact aggtgttacg caaaactctc aacaagccgt ctattggtgg       360
     acaaaagccg ctgaacaggg agctgcagaa gtacaactct atctcggcgt gatgtatgca       420
     aacggacaag gcgttgctca aaactatcaa caagccgtct attggttcac aaaagccgct       480
     gaacaaggca ttgcagaagc acaactctat ctcggcgtga tgtatgcaaa cggacaaggc       540
     gttgctcaaa actatcaaca agccgtctat tggttcacaa aagccgctga acaaggcatt       600
     gcagaagcac aactctatct cggcgatatg tatgaaaaag gacgaggggc acaaaaaaat       660
     gtttctacag ctaaagcatt ctacggtcaa gcatgcgata atggcaacgc tcagggatgt       720
     aaagatttcg ccagattaga taaacagggt gtgcgttaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page