(data stored in ACNUC7421 zone)

EMBL: CP000947.PE183

CP000947.PE183       Location/Qualifiers
FT   CDS_pept        complement(197193..197456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0185"
FT                   /product="Haemophilus-specific protein, uncharacterized"
FT                   /note="KEGG: hso:HS_0314 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31638"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP6"
FT                   /protein_id="ACA31638.1"
FT                   /translation="MSNRIEITVDIYKNFFGDTSDSPYVYDNIKAINPNEQKEVDEIVN
FT                   KMIANGSSQLFDSNLNILNPITPLETGRKCFLNPQTLCIEFK"
     atgtcaaatc gtattgaaat tactgttgat atttataaga atttttttgg agatacctca        60
     gattcgcctt atgtttacga caatataaaa gccatcaatc ctaatgaaca aaaagaggtg       120
     gatgaaatcg tcaataaaat gattgctaat ggcagctctc aattatttga ttctaattta       180
     aatattttga atccaatcac ccctcttgaa acgggaagaa aatgttttct caatccacaa       240
     actttgtgta ttgaattcaa ataa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page