(data stored in ACNUC7421 zone)

EMBL: CP000947.PE184

CP000947.PE184       Location/Qualifiers
FT   CDS_pept        complement(197940..198902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0186"
FT                   /product="lipoic acid synthetase"
FT                   /note="TIGRFAM: lipoic acid synthetase; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   hso:HS_0315 lipoate biosynthesis protein A (lipoate
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31649"
FT                   /db_xref="GOA:B0UVP7"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP7"
FT                   /protein_id="ACA31649.1"
FT                   /translation="MTTPFKMERGVKYRDAAKTSIIPVKNIDPNQELLKKPEWMKIKLP
FT                   ANSAKINSIKNGMRRHGLHSVCEEASCPNLHECFNHGTATFMILGAICTRRCPFCDVAH
FT                   GKPLPPDPDEPKKLAETIQDMKLRYVVITSVDRDDLPDRGAGHFAECVKEIRKLNPGIK
FT                   IEILVPDFRGRIEQALEKLKDNPPDVFNHNLENVPRLYREIRPGADYNWSLKLLKEFKT
FT                   IFPHIPTKSGIMVGLGETNEEILQVMQDLRDNGVTMLTLGQYLQPSRHHLPVARYVPPE
FT                   EFDDFRDKAEKMGFEHAACGPFVRSSYHADLQASGGLVK"
     atgacaaccc cttttaaaat ggaacgtggt gtcaaatatc gtgatgctgc aaaaacgtca        60
     atcattccgg ttaaaaatat cgatccaaat caggagttat taaaaaaacc tgaatggatg       120
     aaaatcaagc ttcctgcaaa ttctgcgaaa attaacagta ttaaaaacgg aatgcgtcgt       180
     catggattac attccgtatg tgaagaagcg tcttgtccaa atttacatga atgcttcaat       240
     cacggcacag caacatttat gattttaggt gcaatttgta cacgccgatg tccattctgc       300
     gatgttgccc atggaaaacc attaccccca gatccggatg aaccaaaaaa attggcggaa       360
     accattcaag atatgaaatt acgttatgtc gttattacat cagtggatcg tgatgattta       420
     ccggatcgtg gtgcgggaca ttttgctgaa tgtgttaaag aaattcgtaa acttaatcca       480
     ggtattaaaa ttgaaatttt ggtgcctgat tttcgtggac gcattgagca agcattagaa       540
     aaattaaaag ataatccccc tgatgttttt aatcataatt tagaaaatgt acctcgttta       600
     tatcgtgaaa tcagaccagg tgcggactat aattggtcgt taaaattact caaagaattt       660
     aaaaccattt ttccacatat ccctaccaaa tcaggcatta tggttggctt gggagaaacc       720
     aatgaagaaa ttttacaggt aatgcaggac ttacgggata acggtgtaac catgttgact       780
     ctaggtcaat atttgcaacc aagtcgccac cacttacctg ttgcccgata cgttccacct       840
     gaggaatttg atgatttccg tgataaagcc gaaaaaatgg gatttgagca tgccgcttgc       900
     ggaccttttg tgcgttcttc gtatcatgct gacttacaag caagtggcgg gctagtcaaa       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page