(data stored in ACNUC7421 zone)

EMBL: CP000947.PE185

CP000947.PE185       Location/Qualifiers
FT   CDS_pept        complement(198920..199576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0187"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: hso:HS_0316
FT                   lipoate biosynthesis protein B (lipoyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31660"
FT                   /db_xref="GOA:B0UVP8"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVP8"
FT                   /protein_id="ACA31660.1"
FT                   /translation="MTDTTLIIRQLGIQDYQQVWQQMREFTDTRNVLTADEIWLVQHPA
FT                   VFTQGQAGKPEHLLNPTDIPVVQSDRGGQITYHGLGQQIMYVLIDIKRHKANGSELNVR
FT                   QLVTALEQSVVSTLADYGIKSYPKADAPGVYVNEQKICSLGLRIRKGCSFHGLALNINM
FT                   DLSPFRQINPCGYIGLEMCQMADFIPTEQAQCDKVAPKLVTHFTQLLGYNDVTTY"
     atgacagata ctactcttat tatacgccaa cttggaatcc aagattatca acaagtttgg        60
     caacaaatgc gagaatttac tgatactcga aatgtgctaa cagctgatga aatttggtta       120
     gttcaacatc cggctgtttt tacacaagga caagcaggta aacctgaaca tttgctcaat       180
     ccaaccgata ttcctgtagt acaatccgat cgtgggggac aaattaccta tcatggctta       240
     ggacaacaaa ttatgtatgt actgattgat attaagcgtc acaaagcaaa cggcagtgaa       300
     cttaatgttc gtcaattagt taccgctctt gagcaatcag tggttagcac actggctgat       360
     tatggtatta aaagttatcc gaaagctgat gcccccggtg tatatgtaaa tgaacaaaaa       420
     atttgttctc ttggtttacg tattcgtaaa ggctgctctt tccatggttt agccttaaat       480
     atcaacatgg atttatcgcc atttagacaa atcaatcctt gtggctatat aggcttagaa       540
     atgtgccaaa tggcagattt tatacccact gaacaagctc aatgtgataa agttgcaccc       600
     aaattagtta cacactttac gcaattattg ggctataatg atgtaacaac ttattaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page