(data stored in ACNUC7421 zone)

EMBL: CP000947.PE186

CP000947.PE186       Location/Qualifiers
FT   CDS_pept        complement(199585..199881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0188"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   hso:HS_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31669"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVP9"
FT                   /protein_id="ACA31669.1"
FT                   /translation="MTDKTVKLNDIPQKQLKDLLEFPCSFTFKVVGKNRADLIDDVVMV
FT                   TQKYAKGDYNPRQNISSKGTYNSISVDIIAENIEQVEILYTELAKIDGVRMVL"
     atgactgaca aaacagtaaa acttaacgac attccacaaa aacaattaaa agatttgttg        60
     gagtttcctt gctcttttac tttcaaagtc gttggtaaaa accgagcaga tttaattgat       120
     gatgtagtta tggtaacgca aaaatacgct aagggtgatt ataaccctcg tcaaaatatc       180
     agtagcaaag gaacttataa ttcaatttct gtagatatca ttgcggaaaa tattgaacaa       240
     gtagaaattc tctatactga actagccaaa attgatggtg tacgcatggt actttaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page