(data stored in ACNUC7421 zone)

EMBL: CP000947.PE188

CP000947.PE188       Location/Qualifiers
FT   CDS_pept        complement(201814..202929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0192"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: hso:HS_0320 rod shape-determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31710"
FT                   /db_xref="GOA:B0UVQ1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ1"
FT                   /protein_id="ACA31710.1"
FT                   /translation="MEKKNIWLILWRRLHIDFWLFLGLVTISSYGLLVLYSAVGGSEKM
FT                   FRNRIIQVALGFTVMFVMAQFSPRFYQRIAPYGFVIGVILLLLVDLFGTTSKGAQRWLD
FT                   LGIFRFQPSEIVKLSVPLMVATYLGKRPLPPKLSEIFIALLLIIVPTLLVAIQPDLGTS
FT                   ILVSASGIFVVFLAGINWWFILIAIVGLAAFTPIVWLYLMHDYQRTRVLTLLDPEKDPL
FT                   GAGYHIMQSKIAIGSGGIWGKGWMQGTQSQLEFLPEPHTDFIFAVLSEEYGMTGFTILM
FT                   LIYLFIVARGLIIGVNAQNSFGRILSGALTLIFFVYVFVNIGMVSGILPVVGVPLPLMS
FT                   YGGTSFVTLMAGFGLIMSIHTHKNNFFKGTK"
     atggagaaaa aaaatatttg gctgattttg tggcgtcgtt tgcatattga tttttggctt        60
     tttctagggt tagtaaccat ttcctcctat ggattgcttg tactttatag tgcggtagga       120
     ggcagtgaaa aaatgttccg caaccgaatt attcaggttg ctctcggttt tactgttatg       180
     tttgtgatgg cacaattttc accaaggttt tatcaacgta ttgcacctta tggatttgtc       240
     attggcgtaa ttttactact gttagtggat ctttttggaa caacaagtaa aggggcacaa       300
     cgttggttag atctagggat ttttcgtttc caaccctctg aaattgttaa attatcagta       360
     ccattaatgg ttgcaacata tttaggaaaa cgtcctcttc cacctaaatt aagtgaaatt       420
     tttattgctt tattattaat aatagtgccg actttattag tagctattca gccagattta       480
     ggaacgtcaa ttttagtcag tgcatccggg atttttgtcg tatttttagc cggaatcaac       540
     tggtggttca tcttaattgc tattgtgggc ttagctgctt ttactccaat tgtatggctc       600
     tatttaatgc atgattacca acgcacaaga gtcttaactc ttttagaccc agaaaaagat       660
     cctttaggtg ctggctacca cattatgcaa tcaaaaatag ccatcggttc gggggggatt       720
     tggggtaaag gttggatgca aggtacacaa tcgcaacttg aattcctacc agaaccacat       780
     acagacttta tttttgctgt attaagtgaa gaatatggta tgacaggatt tacaatacta       840
     atgctcatct atctctttat tgttgcaaga gggttaatta tcggtgttaa tgcacaaaat       900
     tcttttggac gaattttaag tggtgcattg acattaattt tctttgttta tgtatttgtc       960
     aatattggta tggtaagtgg cattctacct gtagttggag tacctttacc tttaatgagc      1020
     tatggaggaa cctcttttgt taccttaatg gctggatttg gtttgatcat gtccattcat      1080
     acacataaaa ataacttttt caaaggaact aaataa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page