(data stored in ACNUC7421 zone)

EMBL: CP000947.PE189

CP000947.PE189       Location/Qualifiers
FT   CDS_pept        complement(202952..204856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0193"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   hso:HS_0321 cell elongation-specific transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31721"
FT                   /db_xref="GOA:B0UVQ2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ2"
FT                   /protein_id="ACA31721.1"
FT                   /translation="MNLKKLLSQPLQTPIRDKKAERNLFARRALIAFLGVLGLSALLFT
FT                   NLYYLQIVNYETYQTRSNGNRIKLLPLPPTRGLIYDRYGKLLAENITFLGLYIVPEKVE
FT                   DLNRTFEELRYIVGLNDDDIENFKKERRRSSRYMPILLKGDLSEEQIARFAVNQYHYPS
FT                   LDIRPYFKRHYLYGEPLTHILGYVAKINEKDVERLKKNEKYANYAGTHDIGKLGIERYY
FT                   EDDLHGKVGFEEVEVNNRGKVIRKLREQPAIAGKSIHLTIDLELQRYIANLLGNLRAAV
FT                   VVLDPKDSGILAMVSTPSYDNNLFVGGISSADYKQLLTDPNRPLYSRVTQGAYPPASTI
FT                   KPFVAIAGLQENLITTNTTIFDPGYWILPNTTKRFRDWKKSGHGYTDLNKAIVESSDTY
FT                   FYQLAYDMGISRLSQWMKRFGFGVPTGIDIQEETAALMPSREWKQKRYKRPWVQGDTIS
FT                   VGIGQGYWTATPLQVAKATAVLVNNGKVNTPHLMKAIEGSEMQPYQDPRLYEDITEPQA
FT                   VFWETIKQSMYNVIHAPNGTGRKSFIDVSYPVAGKSGTAQVFSLKENQTYNANELDNKL
FT                   HDHAWFIGYAPYDNPKMVVVVILENAGGGSSKAGPVVRKIMDYYLNIRLPQVQSQNEK"
     atgaatttaa aaaaattact ctctcaaccc ctacaaacac cgatccgaga taaaaaggcg        60
     gagagaaacc tttttgctcg tcgtgctctt atcgcctttc taggtgtatt gggtttatca       120
     gcacttttat ttaccaattt gtattattta caaattgtca attacgaaac ttaccagaca       180
     agatctaacg gaaatcgaat taaattactt cctttgccac cgactcgagg gctaatttac       240
     gaccgctacg gcaaattatt agcggaaaat attacctttc tcggcttata tattgtgccg       300
     gaaaaagttg aggatttaaa ccgcactttt gaagagttac gctatatcgt tggtttaaat       360
     gatgacgata ttgagaactt taaaaaggaa cgtcgtcgct catcccgata tatgccaatt       420
     ctccttaaag gagatttgag cgaagaacaa atcgcacgct ttgcagtaaa ccaatatcac       480
     tatcccagcc tcgatattag gccttacttt aaacgccact atttgtatgg tgagccgttg       540
     actcatattc taggttatgt cgctaaaatc aatgaaaaag atgtagagcg tttaaagaaa       600
     aatgaaaaat acgccaacta cgccggcact catgatattg gcaagctcgg tattgaacgt       660
     tactatgaag atgacttaca tggcaaagta ggatttgaag aagttgaagt gaataataga       720
     ggtaaggtta ttcgcaaact aagggaacag cctgctattg ccggaaaaag tattcactta       780
     acgattgatt tagaattaca acgttatatc gcaaatttat tgggcaatct tcgtgcagca       840
     gttgtagtat tagatcctaa agatagcggt attttagcaa tggtttctac cccgagctat       900
     gataacaatc tttttgttgg cggtatttca agtgcggatt acaagcaatt actgacagat       960
     cctaatcgcc ctttgtatag ccgtgttact caaggtgctt atccaccggc ttcaacgata      1020
     aaacctttcg ttgctatcgc tggcttgcaa gaaaatttaa ttaccacaaa tactacgata      1080
     tttgacccag gatattggat tttacctaat accaccaaac gttttagaga ttggaaaaaa      1140
     tcagggcacg gctacaccga tttgaataaa gctatagtag aatcttcaga tacttatttt      1200
     tatcaacttg cttacgacat gggcattagc cgtttatctc agtggatgaa acgctttggt      1260
     tttggtgtgc caacaggtat tgatattcaa gaagaaaccg ccgcacttat gccaagtcgg      1320
     gaatggaaac aaaaacgcta caaacgacct tgggttcagg gtgatactat ttctgtagga      1380
     attggtcaag gttattggac agccacccca ttacaagttg ccaaagcaac tgcagtttta      1440
     gttaataatg gcaaggttaa tactccgcac ttaatgaaag caattgaagg gtcagaaatg      1500
     caaccctatc aagatcctcg tctttacgaa gatattactg aacctcaagc ggtattttgg      1560
     gaaacgataa aacaaagcat gtataatgta atacacgcac cgaatggtac aggacgtaaa      1620
     tcttttattg atgtcagtta tcctgttgca ggaaaatcag gaacagctca agttttcagc      1680
     ctgaaagaaa atcaaactta caatgcaaac gaacttgata ataaattgca cgatcatgct      1740
     tggttcatcg gatatgcacc ttatgacaat cctaaaatgg ttgttgttgt tattttggaa      1800
     aatgccggtg gtggtagcag taaggcagga cctgttgttc gaaaaattat ggactattat      1860
     ttaaatatcc gtttgccaca agtacaatca caaaatgaaa aatga                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page