(data stored in ACNUC7421 zone)

EMBL: CP000947.PE19

CP000947.PE19        Location/Qualifiers
FT   CDS_pept        complement(16190..16516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0019"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hso:HS_0153 conserved hypothetical protein, with TPR
FT                   repeat (tetratrico peptide repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31688"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX7"
FT                   /protein_id="ACA31688.1"
FT                   /translation="MNLKKSLLTALLSFGIVQSTLAETDTERFNRALQFIKQQNYSDAF
FT                   PLFKQLAEQGDANAQHNLGVMYENGQSVQRNVSKAKQYYRLACDNGLNIGCQTYAKLDK
FT                   KGIK"
     atgaatctaa aaaaatccct ccttaccgcc ctactctctt tcggtattgt ccaatctaca        60
     cttgccgaaa cagataccga aagatttaat cgtgctttac aatttattaa acaacaaaat       120
     tattctgacg catttccctt attcaaacaa ctggctgaac agggagatgc aaatgcacaa       180
     cacaatctcg gcgtgatgta tgaaaacgga cagagtgtac aaagaaatgt ttctaaagct       240
     aaacaatatt atagattagc gtgcgataat ggcttaaaca ttggctgtca aacgtatgca       300
     aaactagaca agaagggtat aaaatag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page