(data stored in ACNUC7421 zone)

EMBL: CP000947.PE190

CP000947.PE190       Location/Qualifiers
FT   CDS_pept        complement(204873..205340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0194"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   hso:HS_0322 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31732"
FT                   /db_xref="GOA:B0UVQ3"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVQ3"
FT                   /protein_id="ACA31732.1"
FT                   /translation="MKIQLIAVGTKMPDWVTKGFEEYQRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILEQEGKAMLSACQKSRIITLDIPGKPWTTEQLAQQLEAWKHDGRNVALLIGG
FT                   PEGLSPECKAATEQSWSLSPLTLPHPLVRIVVAESLYRAWSLSTNHPYHRE"
     atgaaaattc aattaattgc cgttggcact aaaatgcctg attgggtcac aaaaggcttc        60
     gaggagtatc aacgtcgttt tcccaaagat atgccttttg agctaataga aatcccggca       120
     ggaaaacgtg gaaaaaatgc ggatattaaa cgtattctcg aacaagaagg taaagctatg       180
     ttatccgctt gtcagaaaag tcgtattatt accttagata ttcccggtaa accttggaca       240
     actgagcaat tagcacagca attagaagca tggaaacatg acggtcgaaa tgttgcactc       300
     ttaattggtg gtccggaagg attatcacct gaatgcaaag ctgcgacaga acaaagttgg       360
     tctctttcgc ctttaacttt acctcatccc ttggtacgta tcgttgtggc tgagagttta       420
     taccgtgctt ggtcgttaag cacaaatcat ccttatcacc gagaataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page