(data stored in ACNUC7421 zone)

EMBL: CP000947.PE191

CP000947.PE191       Location/Qualifiers
FT   CDS_pept        complement(205360..205668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0195"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: hso:HS_0323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31743"
FT                   /db_xref="GOA:B0UVQ4"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ4"
FT                   /protein_id="ACA31743.1"
FT                   /translation="MNLVDFLVSKLDDLKGTDILALDVRGKSSITDHMILCTGTSSRHV
FT                   ISLAQKLIDESKQAGIDTFGEEGKSTADWIAIDFGQAIVHIMQADSREMYQLEKLWG"
     atgaacttag tcgattttct agtgagtaaa ttagatgatt taaaaggcac agatatttta        60
     gcccttgatg ttagaggtaa atcttctatt accgatcaca tgattttatg tacaggaacg       120
     tcaagtcgcc atgtaatctc tttggcacag aaattaattg atgaaagtaa gcaagccggc       180
     attgatactt ttggcgaaga gggcaaatct accgcagatt ggattgcgat agattttggt       240
     caagccattg tacacattat gcaggctgac agtcgtgaaa tgtatcagct ggaaaaactt       300
     tggggataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page