(data stored in ACNUC7421 zone)

EMBL: CP000947.PE192

CP000947.PE192       Location/Qualifiers
FT   CDS_pept        complement(206021..206863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0196"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: hso:HS_0325 chelated iron
FT                   ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31754"
FT                   /db_xref="GOA:B0UVQ5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ5"
FT                   /protein_id="ACA31754.1"
FT                   /translation="MFNTIVAWFTEPLVYPFMQQAIIIAPIIGAVCAILSCYLVLKGWS
FT                   LMGDAISHAVLPGIILAYVLAIPIAIGAFWAGIFCAVSVGYLRDNSRIKEDTVMGIVFS
FT                   GMFAFGLVLFSKVETDQHLMHILFGNILGIIKQEFWQSIGIALLAFILIALKRKDLLLY
FT                   CFDPSHTRVAGLNTKFLHYGLLVILALVIISAMQVVGVILVVAMLITPGITGYILAKRF
FT                   DYMMLIAVCTAVFSGIFGVLLSFHFNVATGPCIILLQASLFLCALGYSKYIAMRVVNI"
     atgtttaata cgattgtagc gtggtttacc gagcccttgg tgtatccatt tatgcaacaa        60
     gctattatca tcgcacctat cattggggca gtatgtgcga ttttatcgtg ttatttagta       120
     cttaaaggct ggtcactaat gggtgatgcc atttctcacg ctgtattgcc gggaattatt       180
     cttgcctatg tattagcaat tccgattgcg attggggcat tttgggcagg catcttttgt       240
     gcagtttccg taggttattt gagagataac agccgaatca aagaagacac agtgatggga       300
     attgtttttt caggaatgtt tgctttcggt ttggtgctgt tttccaaagt ggaaaccgat       360
     caacatctaa tgcacattct gttcggaaat attctaggca tcattaagca agaattttgg       420
     caaagtattg gcattgcatt actggcattt atcctgattg ccttaaaacg caaagacttg       480
     ttgctttact gttttgatcc aagtcacaca cgagttgcag gacttaacac caaattttta       540
     cactatggtt tactggtaat cctagcgtta gtcatcatca gtgcaatgca agttgttggc       600
     gttattttag tggtggcaat gctcattaca cctgggataa caggctatat tttagctaaa       660
     cgctttgatt atatgatgct aattgccgtt tgcacagcag tattcagtgg tatttttggc       720
     gtattgctca gttttcattt caacgtcgcc acaggacctt gtattatctt acttcaagca       780
     agcctttttt tatgtgcctt aggttatagt aaatatatcg cgatgcgtgt agttaatatt       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page