(data stored in ACNUC7421 zone)

EMBL: CP000947.PE193

CP000947.PE193       Location/Qualifiers
FT   CDS_pept        complement(206856..207746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0197"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: hso:HS_0326 chelated iron ABC transporter,
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31765"
FT                   /db_xref="GOA:B0UVQ6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ6"
FT                   /protein_id="ACA31765.1"
FT                   /translation="MLELLLEPFSYDFMFKAIVVSGAIGAVCAFLSAYLMLKGWSLIGD
FT                   ALSHAVVPGVAIAYALALPYAVGAFFSGLLATIAILAVKYVTKLKEDAVIGFIFTSFFA
FT                   LGLLIISINPTSVNVQSIVLGNILGIADEDMIQVAIILGISFVLLLLFWKDLMLVFFDE
FT                   IQAKAVGLSPLKFKILFFTLLSACIVTALQGVGAILVIAMVITPGATAYLLTDRFDRLL
FT                   IISILLGGTTSSLGAYLSYFADSATGGFIVSLQTFIFLLAFFFAPKYGLIPRKRSTQKA
FT                   VTSSPNLANQEKPNV"
     atgttagagc tattacttga gccgttttct tatgatttta tgtttaaggc gattgtggtc        60
     agtggtgcca ttggagcggt ttgtgctttt ctttccgctt atttaatgct gaaaggttgg       120
     tcactgatcg gtgatgcgtt atcccacgcc gttgtcccag gcgttgctat tgcctatgcc       180
     ttggcattac cttatgccgt cggggctttt ttctctgggc tacttgccac tattgccatt       240
     ttagcagtga aatacgtgac taaactcaaa gaggatgcag taatcggttt tattttcacc       300
     tctttcttcg ctctcggatt gttgattatt tcaattaatc ccacttccgt gaacgtacaa       360
     tctatcgttt tgggcaatat tttaggtatt gccgatgaag atatgatcca agtcgctatt       420
     attctcggta tatcatttgt attgttgcta ctcttttgga aagacctaat gcttgtgttc       480
     tttgatgaaa ttcaagccaa agcggtaggg ctatcgcctt taaaattcaa aattttattc       540
     tttaccttgt taagtgcatg cattgtaacc gccttacaag gagtaggggc tattttggta       600
     attgcgatgg tgattacacc tggagcaaca gcatatttgc tcaccgatcg cttcgatcgc       660
     ctgttgatta tttcgatttt actcggtggt actactagct cactaggagc atatttgagt       720
     tatttcgcag acagtgcaac tggtggcttt attgtatcat tgcaaacgtt catcttctta       780
     cttgctttct tttttgctcc caaatatggt cttattccac gtaagcgaag tacacaaaaa       840
     gcagtgactt cctcaccaaa tcttgcaaat caggagaagc caaatgttta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page