(data stored in ACNUC7421 zone)

EMBL: CP000947.PE195

CP000947.PE195       Location/Qualifiers
FT   CDS_pept        complement(208519..209400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0199"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   hso:HS_0328 chelated iron ABC transporter,
FT                   periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31787"
FT                   /db_xref="GOA:B0UVQ8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ8"
FT                   /protein_id="ACA31787.1"
FT                   /translation="MSRLLIVMGVILGSVFSLPSYAKFKVVTTFTVIQDIAQNVAGDAA
FT                   VVESITEPGAEIHDYEPTPQDIVKAQSADLVLWNGMNLERWFERFFTQVKDKPAVVVTK
FT                   GIDPISIYEGPYKGMPNPHAWMSTKNALVYIENIREALVKYDPKNADTYNANAKAYADK
FT                   IVALDAPLRAELEKVPASQRWLVTSEGAFSYLAHDYGFKELYLWPINAEEQGTPKQIKN
FT                   VIKKVREHKIPVVFSESTISDKPAKQVAKETNAKYGGVLYVDSLSTKDGKVPTYIDLLN
FT                   VTVSTIVNGFKK"
     atgtcacgtt tacttattgt tatgggtgta atcttaggtt ctgtattcag tttaccaagt        60
     tacgcaaaat ttaaagtagt tactactttt accgttattc aagatatcgc tcagaatgtt       120
     gctggtgatg ctgctgttgt tgagtcgatc actgagccgg gtgcagaaat tcatgattat       180
     gaaccaactc cacaagacat cgtaaaagca caatctgctg atttggtgct ttggaatgga       240
     atgaatttag agcgttggtt cgagcgtttc tttacccaag tgaaagataa accagctgtt       300
     gttgtaacta aagggattga tccaatttct atctacgaag gtccatacaa aggtatgccg       360
     aatccacatg cttggatgtc aaccaaaaat gctttggtat acatcgaaaa cattcgtgaa       420
     gctttagtga aatacgatcc taaaaatgca gacacttaca atgctaatgc aaaagcctat       480
     gcagataaaa tcgttgcttt agacgcacca ttacgtgccg agttagaaaa agtaccagct       540
     tcacaacgtt ggttagtaac cagtgaaggt gcattcagct acttagctca cgactacggt       600
     ttcaaagagc tttatttatg gcctatcaat gctgaagaac aaggcacacc aaaacaaatc       660
     aaaaatgtaa tcaaaaaagt acgtgaacac aaaatccctg ttgtgttcag cgaaagcacc       720
     atttctgata agccagcaaa acaagtggct aaagaaacca atgcaaaata cggtggtgta       780
     ctttatgtag attcactttc tacaaaagat ggtaaagtac caacttacat cgacttatta       840
     aatgtaactg tttcgaccat tgtgaatggt ttcaaaaaat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page