(data stored in ACNUC7421 zone)

EMBL: CP000947.PE196

CP000947.PE196       Location/Qualifiers
FT   CDS_pept        complement(209506..209835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0200"
FT                   /product="DsrC family protein"
FT                   /note="PFAM: DsrC family protein; KEGG: hso:HS_0329 sulfite
FT                   reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31800"
FT                   /db_xref="GOA:B0UVQ9"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVQ9"
FT                   /protein_id="ACA31800.1"
FT                   /translation="MLSVNQVQIETDVEGYLLDMNQWNKDVAIAIAKSENIELTEAHWE
FT                   IINFVRDFYQEYKTSPAMRMLVKALGQKLGADKGNSRYIQRLFPEGPAKQASKLAGLPK
FT                   PIKCL"
     atgttaagtg ttaaccaagt tcaaattgaa actgatgttg agggctatct attagatatg        60
     aatcagtgga ataaagatgt cgctatagcc attgcaaaat cagaaaatat cgaattaacc       120
     gaagcccact gggaaattat taactttgta agggattttt atcaagagta taaaacctca       180
     ccagcaatga gaatgttagt caaagcattg ggacaaaagc taggtgcaga taaaggcaat       240
     agtcgttaca tacaacgttt attcccagaa ggtcccgcaa aacaagcttc aaaattagct       300
     ggtttaccca aaccaataaa atgtctttaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page