(data stored in ACNUC7421 zone)

EMBL: CP000947.PE197

CP000947.PE197       Location/Qualifiers
FT   CDS_pept        complement(209913..210575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0201"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   hso:HS_0330 conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31811"
FT                   /db_xref="GOA:B0UVR0"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVR0"
FT                   /protein_id="ACA31811.1"
FT                   /translation="MQSRFIVDTKEESVLATNKVLRNTYFLLALTLAFSSVVAFSAMQL
FT                   NLPPLHFGVMLIGFYGLLFLNNMLANSAWGLLSTFALTGLLGYSLGPILSYYVGSGLGD
FT                   LVVLALAGTASVFFTCSAYVLTTKKDMSFLSGMMLALFIVLVIGMIASFFFNMSGFHIV
FT                   FSSLFIVFSTMAILYETSNIIHGGETNYIRATVSLYVSLYNLFVSLLNLLGIFNRDE"
     atgcaatctc gttttattgt tgatactaaa gaagaatcgg tactggcaac aaataaggtt        60
     ttacgtaaca cctacttttt attagcattg acattggctt tttcttctgt tgtcgccttc       120
     agtgcaatgc aattaaacct ccctccactt catttcggtg tcatgttgat aggtttttat       180
     ggattattat tcctcaataa tatgttagca aacagtgctt ggggactttt atctacattc       240
     gcattaacag gattattagg ctattcttta ggtcctattt taagctatta tgttggctca       300
     ggattaggtg atttggttgt tcttgctcta gccggaactg caagtgtatt ttttacatgc       360
     tcggcctatg tgctaacaac aaaaaaagat atgtcattct tatccggcat gatgcttgct       420
     ctctttatcg tattggttat aggcatgata gcaagtttct tctttaatat gagtggcttt       480
     cacatcgtat ttagttcgtt atttatcgtt ttctcaacta tggctatttt atatgaaact       540
     agcaatatca ttcatggggg agaaactaat tatattagag ctacggttag tttgtatgtt       600
     tcactttaca atctttttgt cagcttgctc aatttactag gtattttcaa ccgtgatgaa       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page