(data stored in ACNUC7421 zone)

EMBL: CP000947.PE198

CP000947.PE198       Location/Qualifiers
FT   CDS_pept        complement(210983..212512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0202"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   hso:HS_0331 competence-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31822"
FT                   /db_xref="GOA:B0UVR1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVR1"
FT                   /protein_id="ACA31822.1"
FT                   /translation="MSLAVVYSRASMGVQAPLVTIEVHLSNGKPAFTLVGLPEKTVTEA
FT                   QGRVRSALLNAQFKYPAKRITVNLAPADLPKEGGRFDLPIALGILAASEQINAKKLQQF
FT                   EFVAELALTGELRGVHGVIPAILAGQKSKRQLIVAQQNANEASLVSQHETFFARNLLEV
FT                   VQFLNDDSSLPSSTTLCMQSAVDFSPQSNKDLTDIIGQQHAKRALMIAAAGQHNLLFLG
FT                   PPGTGKTMLASRLTGLLPDMTDQEAIETASVTSLVQNELNFQNWKQRPFRAPHHSASSP
FT                   ALVGGGTIPKPGEISLAHNGVLFLDELPEFERRVLDALRQPLESGEIIISRANAKIQFP
FT                   ARFQLVAAMNPSPTGHYTGIHNRTSPQQVLRYLNRLSGPFLDRFDLSIEVPLLPQGALQ
FT                   NTEDRGETTAQVKEKVLRVREIQLARAGKVNAYLTGKEIERDCKLTEQDALFLENTLTR
FT                   LGLSVRAYHRILKVARTIADLNGDSDIKQNHLAEALSYRAMDRLLRKLSDQ"
     atgtcattag cagttgttta tagtcgagca tcaatgggcg tacaagcacc tttggtgaca        60
     attgaagttc acttgagtaa tggaaaacct gcttttaccc tcgttggatt accggagaaa       120
     acagtaactg aggctcaagg acgagtacgt agtgcattac tcaatgctca atttaaatac       180
     ccagcaaaac gcattacagt taatcttgct ccggcagatt tgccaaaaga gggagggcgt       240
     tttgatttac ctattgcact cggcatctta gcggcctcgg aacagattaa tgcaaaaaag       300
     ttacaacaat ttgaatttgt tgcagagttg gctctcacag gtgagttaag aggcgtacac       360
     ggtgtgatcc ctgctatttt agcggggcaa aaatctaagc gtcaacttat tgtcgcacaa       420
     caaaatgcta atgaagcctc tttagtttca caacacgaaa cattttttgc acggaactta       480
     ttggaggtcg tacaattcct gaatgacgac agttcgctac cttcatccac aacgttatgt       540
     atgcaaagtg cggtggattt ttcacctcaa tctaataaag atctgacgga tattattggt       600
     caacaacatg ctaaacgagc cttaatgatt gcagctgccg gacaacataa tttgttgttt       660
     ctcggaccgc ccggcacagg taaaaccatg ttagcaagcc gtctaactgg cttgctaccg       720
     gatatgacag atcaagaggc aatagaaacc gcctctgtaa caagtttggt acaaaacgaa       780
     ttaaattttc aaaattggaa acaacgtcct ttccgtgcac ctcatcatag tgcctcatca       840
     ccagcattgg ttggaggagg aacaattccg aaaccgggag aaatttcttt ggctcataac       900
     ggtgtattat ttttagacga attacccgaa tttgaacgga gagtgctgga tgctttacgc       960
     cagcctttag aaagcggaga aataattatt tcacgtgcga atgcaaaaat tcagtttccg      1020
     gcacgttttc aattagtggc agcgatgaat ccaagtccaa cgggacatta taccggtata      1080
     cacaaccgca cttcaccaca acaagtgttg cgttatttga acagactttc cggtcctttt      1140
     ttagatcgct ttgatctttc cattgaagtg cctttacttc cacaaggtgc tttgcaaaat      1200
     accgaagatc gaggtgaaac aacagcacaa gttaaagaaa aagtattaag ggtcagagaa      1260
     attcagctag ctagagccgg aaaagtcaat gcttatttaa ccggtaaaga aattgagcga      1320
     gattgcaagt tgactgagca agatgcacta tttttagaaa atactttaac cagactcggt      1380
     ttatctgttc gtgcttatca tcgaatttta aaagttgcac gcactatcgc cgatttaaac      1440
     ggagattctg atatcaaaca aaaccactta gctgaagcat taagctatcg agccatggat      1500
     cgtttgctac ggaaactatc agaccaataa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page