(data stored in ACNUC7421 zone)

EMBL: CP000947.PE199

CP000947.PE199       Location/Qualifiers
FT   CDS_pept        complement(212614..213309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0203"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   hso:HS_0332 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31825"
FT                   /db_xref="GOA:B0UW08"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW08"
FT                   /protein_id="ACA31825.1"
FT                   /translation="MYKKMSWLLLVFHNAIFPIGNDLSENKMTNIKLNYHKTHFLMSAP
FT                   NIQVLPEDSGIEIAFAGRSNAGKSTALNALTQQKNLARTSKTPGRTQLINLFQVEPNCK
FT                   LVDLPGYGYAAVPEQMKLQWQKSLGEYLQKRECLGGLVILMDIRHPLKDLDQQMIEWAV
FT                   SADLPVLLLLTKADKLSQSARSKQVKMVRESILPFQGDVQVEAFSAQNKIGIERLSEKL
FT                   DQWFSPLFS"
     atgtacaaga aaatgagttg gttattactc gtgttccaca acgccatatt tccaattggc        60
     aacgacctaa gcgaaaataa aatgacaaac ataaaattaa attatcataa aacccatttt       120
     ttaatgagtg cacctaatat ccaggtattg cctgaggata gtgggattga gattgctttt       180
     gcaggacgat ctaatgcagg aaaatctacc gcacttaatg cgttgaccca gcaaaaaaat       240
     ttagcaagaa cttcaaaaac accgggacgt actcagttaa tcaatttatt tcaagtagaa       300
     cccaattgta agctggtaga tctgccggga tatggctatg ccgctgttcc cgaacaaatg       360
     aaacttcagt ggcaaaaatc tttaggtgag tatctgcaaa aaagggaatg tttaggtggt       420
     ttggttattt taatggacat tcgtcatcct ctaaaagatc ttgatcaaca gatgattgaa       480
     tgggcggttt ccgcagattt accggtttta ttattgctca caaaagcgga taaattgagt       540
     caaagtgcga gaagtaagca agtaaaaatg gttcgagaat cgattttacc tttccaaggt       600
     gatgtacaag ttgaagcctt ttccgcacaa aataaaatcg gtatcgaacg cttatccgaa       660
     aaattagatc agtggttttc tccgcttttt agctaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page