(data stored in ACNUC7421 zone)

EMBL: CP000947.PE2

CP000947.PE2         Location/Qualifiers
FT   CDS_pept        1658..2758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: hso:HS_0137 DNA-directed
FT                   DNA polymerase, beta subunit (DNA polymerase III, beta
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31798"
FT                   /db_xref="GOA:B0UUL9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUL9"
FT                   /protein_id="ACA31798.1"
FT                   /translation="MQFIVSREHLLKPLQQVCGVLSSRPNFPILNNVLLQIEGNVLRIT
FT                   GTDLEVELSTQAQLIQASQDGSYTIPAKKFLDICRSFPDEAEITVIFEEERALVRSGRS
FT                   KFNLTALPADEYPNLADWQSEVDFYLPQSTLRRLIEATQFSMANQDARYFLNGMKFETE
FT                   GNLLRTVATDGHRLAVCTIPLEQDLHTHAVILPRKGILELMRLLENSEHAAHVQIGTNN
FT                   LRIDLGSIIFTSKLIDGRFPDYRRVLPRNATHIMEGNWELLKQAFARMAILSSDKVKTV
FT                   RLQLTSNQLKITATNPEQEVAEEILDVIYNGADMEVGFNVSYILDVLNALKCQQVRLCF
FT                   TDASSSCLLEDADDESAEYVVMPMRL"
     atgcaattta ttgtttcaag agaacatcta ttaaaaccat tacaacaagt ttgtggtgta        60
     ttaagtagtc gtccaaattt tcctatatta aacaatgtat tattgcaaat tgaggggaat       120
     gttttacgta ttaccggtac agatctcgaa gtagaacttt caacacaagc acaacttatt       180
     caagcatcgc aagacggtag ttatacgatt ccggcaaaaa aattcttaga tatttgccgc       240
     agttttcccg atgaagcgga aattactgta atttttgaag aagagcgtgc attggtgaga       300
     tccggtcgaa gtaaatttaa tttaaccgct ttacctgcag acgaatatcc taatttagct       360
     gattggcaat cagaggtgga tttttacctg cctcaaagta cattacgtcg cctaattgaa       420
     gcaacacaat tctctatggc aaaccaagat gctcgttatt tcctaaacgg tatgaagttt       480
     gaaactgaag gcaatttact acgaacagtt gctactgatg gacatcgact cgccgtttgc       540
     acaattccgt tagagcagga tttgcataca catgcagtca ttttgcctcg caaaggaata       600
     ttagagttaa tgagattact ggaaaacagc gaacacgctg ctcacgttca aattggcaca       660
     aataatttac gcattgattt aggaagtatt atttttacat caaaattaat tgatggtcgt       720
     ttcccagact atcgtagagt tctcccaaga aatgcaactc atattatgga aggtaattgg       780
     gaactgctga aacaagcttt tgctcgtatg gcaattctgt ctagcgataa agttaaaact       840
     gtccgtttgc aattgacctc aaatcaatta aagattacag caacaaatcc ggaacaagaa       900
     gtggctgagg aaattttaga tgtcatatat aatggggcag atatggaagt tggctttaat       960
     gtaagttata ttttagatgt acttaatgcc ctaaaatgcc aacaggtgcg attatgtttt      1020
     actgatgcct catcaagttg tttattagag gatgctgatg atgaaagtgc agagtatgtc      1080
     gttatgccaa tgcgtctata a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page