(data stored in ACNUC7421 zone)

EMBL: CP000947.PE20

CP000947.PE20        Location/Qualifiers
FT   CDS_pept        complement(16560..17357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0020"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; serine
FT                   acetyltransferase domain protein; KEGG: hso:HS_0154 serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31799"
FT                   /db_xref="GOA:B0UUX8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX8"
FT                   /protein_id="ACA31799.1"
FT                   /translation="MSIEVWSLIRAEAAKLAENEPMLASFFHATILKHNNLGSALSYIL
FT                   ANKLANPIMPAIALREIIEEAHQNQPQIIESAACDIRAVRHRDPAVEQYSTPLLYLKGF
FT                   HALQSYRITHYLWQQGRKALAIYLQNQISVAFDVDIHPAARIGCGIMFDHATGIVIGET
FT                   SVIENDVSILQGVTLGGTGKESGDRHPKIREGVMIGSGAKVLGNIEIGRYAKIGANSVV
FT                   LQFVSEYTTVAGVPSQIVGKNKGAKPAFDMDQYFIDDAINLNI"
     atgtcaatag aagtatggag tcttattcgt gctgaagcag caaaactcgc tgaaaatgaa        60
     ccaatgctag ccagtttctt tcatgcaact atcttaaaac ataacaatct aggcagtgca       120
     ttaagctata ttcttgcgaa caaattagct aatccaatta tgcccgctat tgcattgcga       180
     gaaattattg aagaagcaca tcaaaatcaa ccgcaaatta tcgaaagtgc ggcttgcgat       240
     atccgagccg tgcgtcatcg agatcctgcc gtagaacaat actctacacc gttactttat       300
     ttgaaaggct tccacgcatt gcaaagttat cgtattaccc attatttatg gcaacaagga       360
     cgaaaagcat tggcgatcta tttacaaaac caaatatccg ttgcctttga tgtagatatc       420
     catcccgcgg caagaatcgg ttgtggcatt atgttcgatc atgccacagg tattgtgata       480
     ggagaaacat ctgtcattga aaatgatgta tctattttgc aaggtgtaac tttaggggga       540
     acgggtaaag aaagcggcga tcgtcatcct aaaattcgag aaggtgtgat gattgggtcc       600
     ggagctaaag tgttaggaaa tatcgaaatt gggcgttacg ctaaaattgg tgcaaactcc       660
     gtagtgttac aattcgtttc agaatacact actgtcgctg gtgtgccttc tcaaatagta       720
     ggcaaaaata aaggggcgaa acctgcattt gatatggacc aatactttat tgatgatgca       780
     attaacttaa atatctaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page