(data stored in ACNUC7421 zone)

EMBL: CP000947.PE200

CP000947.PE200       Location/Qualifiers
FT   CDS_pept        complement(213230..214612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0204"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: hso:HS_0333
FT                   UDP-N-acetylglucosamine diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31826"
FT                   /db_xref="GOA:B0UW09"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW09"
FT                   /protein_id="ACA31826.1"
FT                   /translation="MTKRKFIMNKLSVVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVI
FT                   DTAKKLSAAQIHLIYGHGADLLKQHLADEPVNWVFQSEQLGTGHAMQQAVPFFQDDENI
FT                   VMLYGDVPLISKETLECLISQKPENGIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDA
FT                   NPEQLKITEVNTGVMVSDGASFRKWLARLDNNNAQGEYYMTDVIGLANQDGFKVVAVQA
FT                   KDLMEVEGVNNRLQLANLERHYQRKQVEKLLLAGVTFADPARFDLRGELTHGKDVEIDI
FT                   NVIIEGTVRLGNNVFIGAGCVLKNCTIADNVEIKPYSVIEDAIVGNNAKIGPFSRLRPG
FT                   AELSENTHVGNFVEIKKAQIGKGSKVNHLTYIGDAEVGHHCNIGAGVITCNYDGANKFK
FT                   TLIGDNVFVGSDSQLVAPLTIASGATIGAGTTVTKDVQENELVITRVPQRHISNWQRPK
FT                   RK"
     atgacaaaga gaaaatttat catgaacaaa ttaagcgttg ttattcttgc cgccggtaaa        60
     ggaactcgca tgtattcgga tttacctaaa gtattgcaca aaattgcagg taaaccgatg       120
     gttaaacatg tgattgatac cgccaaaaaa ttaagtgcgg cacaaattca tttaatttat       180
     ggacatggtg ctgatctact aaaacaacat ttggctgatg aacctgtaaa ctgggtattc       240
     caatctgaac aattaggtac agggcatgca atgcaacaag cagtgccttt tttccaagat       300
     gacgaaaata ttgtgatgtt atatggtgat gtacctttaa ttagcaagga aacccttgag       360
     tgtttaattt cacaaaaacc ggaaaatggt atcgcacttt tgaccgttaa tttagacaat       420
     cctacaggtt atgggcgagt gattcgagaa aatggtacgg taacggcaat tgttgaacag       480
     aaagacgcta atcctgagca gctaaaaatt acggaagtga atacaggcgt tatggtatcg       540
     gacggtgcaa gtttccgtaa atggctagct cgtttagata ataataatgc acaaggtgaa       600
     tattacatga cagatgtaat aggacttgcc aatcaagatg gcttcaaagt tgtagcggta       660
     caagctaaag atcttatgga agtagaggga gtaaataacc gtttacaatt agctaattta       720
     gaacgtcatt atcaacgtaa gcaagtagaa aaattgttac ttgcaggtgt tactttcgct       780
     gatcctgcac gttttgattt gcgtggtgaa ttaactcatg gtaaagatgt ggaaattgat       840
     ataaatgtaa ttatcgaagg aacggtacga ttaggcaata atgtgtttat tggggcaggt       900
     tgtgtactga aaaattgtac gattgcagat aatgtggaaa taaaacctta ttctgtgatt       960
     gaagatgcca ttgtgggcaa taatgccaaa attggaccat tctcaagatt acgtccggga      1020
     gctgagttga gcgaaaatac tcatgtgggt aacttcgttg agatcaaaaa agcacaaatt      1080
     ggcaaggggt ctaaagtaaa tcatctcact tatattggcg atgctgaggt tggacatcat      1140
     tgtaatatcg gtgccggtgt tattacttgt aattatgacg gtgccaataa atttaagaca      1200
     ttgattggcg ataacgtttt tgtcggttcc gatagtcagc tagttgcacc attaacaatt      1260
     gcaagcggtg caacgattgg tgcaggaaca accgtcacca aagatgtaca agaaaatgag      1320
     ttggttatta ctcgtgttcc acaacgccat atttccaatt ggcaacgacc taagcgaaaa      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page