(data stored in ACNUC7421 zone)

EMBL: CP000947.PE201

CP000947.PE201       Location/Qualifiers
FT   CDS_pept        214658..215815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0205"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   hso:HS_0334 possible molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31827"
FT                   /db_xref="GOA:B0UW10"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW10"
FT                   /protein_id="ACA31827.1"
FT                   /translation="MLLCLANIRSSFMQKNNHYYIGIMSGTSLDGVDIALMDFNQRPPK
FT                   LLASHCFSMPENLRQQLTALLKNGEIGLQQLGELDHQLGLLYANSVQRFLAQNQMTADS
FT                   IQAIGCHGQTIWHSPQGQYPFTMQIGDANLISVLTGITTIADFRRKDMAHGGQGAPLSP
FT                   AFHQALFAQPDRITVVLNIGGISNISCLIPEQEVIGYDTGVGNALMDSWIEQHLGVPFD
FT                   QDGEWAKSGSVHQDLLKDLLDEPFFQQLPPKSTGRELFNLAWLNKKLKKHTALSAQDVQ
FT                   ATLLEFTVQCTVQELVKLTNPNHLPCLLLVCGGGAKNRQLMARLQACLPQWHVATTTEH
FT                   GLSVDYVEAAAFAWLAYQRINHLPSNLPSVTGAKSAVSLGVIYPK"
     atgttattat gtttagcaaa catacgttct tcttttatgc aaaaaaataa tcactattat        60
     attggaatta tgtccggtac aagtttagac ggtgttgata tagccttaat ggattttaat       120
     caaagaccgc ccaagctact tgcaagccat tgtttctcta tgccggaaaa tttacgccaa       180
     caactcaccg cacttttaaa aaacggagaa attggcttac agcaattagg cgagttggat       240
     catcaactgg gattacttta cgcaaactcg gtacaacgtt tcttagcaca aaatcaaatg       300
     accgctgata gtattcaagc catcggttgt catggacaaa cgatttggca ttcaccccaa       360
     ggtcaatatc ctttcactat gcaaattggc gatgctaacc tgattagtgt actgacagga       420
     attacgacta tcgctgattt tcgtcgcaaa gatatggctc atggtggaca aggtgcacct       480
     ttgtcccctg catttcatca agccttattt gcacaacccg atcgcattac ggtagtgtta       540
     aatattggcg gtatcagtaa tatttcttgt ttaattccgg aacaagaagt tattggttat       600
     gataccggtg taggtaatgc tttgatggat agttggattg aacaacattt aggggtgcct       660
     ttcgaccaag acggtgaatg ggcaaagagc ggtagtgttc accaagattt gctaaaagat       720
     ttattggacg aacctttttt tcaacaactt ccccctaaaa gtaccggacg ggaattattt       780
     aatttggcgt ggttgaacaa aaaactgaaa aaacataccg cactttctgc acaagatgta       840
     caggcaacgt tgctggaatt tacggtacaa tgcacggtgc aagagctggt taaactcact       900
     aatccgaacc atttgccttg tttgttgttg gtttgtggcg gtggtgcaaa aaacagacaa       960
     ctaatggctc gtttacaagc ctgtttaccg caatggcacg tagcaacaac tacagagcat      1020
     ggtttatcgg ttgattatgt tgaagccgcc gcttttgctt ggttagcgta tcagcgtata      1080
     aatcatttac cctctaattt accaagtgta accggtgcta aaagtgcggt cagtcttggc      1140
     gttatttatc cgaaataa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page