(data stored in ACNUC7421 zone)

EMBL: CP000947.PE202

CP000947.PE202       Location/Qualifiers
FT   CDS_pept        215818..216729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0206"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; PFAM:
FT                   sugar isomerase (SIS); KEGG: hso:HS_0335 glucokinase
FT                   regulator-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31828"
FT                   /db_xref="GOA:B0UW11"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW11"
FT                   /protein_id="ACA31828.1"
FT                   /translation="MNKQNLINQFAQLITEQPNPLSVNLDQMSALEIVQLMNKEDQQVP
FT                   LVIAKALPEIAVVVEKIVAAFRQGGRLVYLGAGTSGRLGVLDASECPPTFGVNHEMVKG
FT                   IIAGGEQAIRYPVEGAEDNQQAAIVDLQAIQLCSKDILVGIAASGRTPYVISGLKYAKE
FT                   IGSFTVAIASNPQSAMAKIADIGIETIVGPEILTGSSRLKSGTAQKLVLNMLTTASMVL
FT                   LGKCYQNLMVDVQASNEKLVDRATRIIMQATGCERAKAEQTLTQADNNAKLAILMILMD
FT                   LDKQSAVDLLAKNQDKLRQTLD"
     atgaataaac aaaatttaat taatcagttc gctcaactaa ttaccgagca acccaatcca        60
     ctctcagtaa atttggatca aatgtctgca cttgaaattg tacaattgat gaataaagaa       120
     gatcagcaag ttccactcgt catagcaaaa gcacttccgg aaattgccgt tgtagtggaa       180
     aaaatcgttg ctgcttttcg tcaaggtgga cgcttagtgt atcttggagc ggggacaagt       240
     gggcgtttag gcgttttaga tgcctctgaa tgtcccccaa cctttggtgt taatcatgaa       300
     atggtaaaag gcattattgc cggaggagaa caggctatcc gttatcctgt ggaaggcgct       360
     gaggataatc aacaagcggc aatagtagat ctgcaagcaa tccaattatg ttcaaaagat       420
     attttagtgg gtattgctgc gagcggtcgt acaccttatg tcatcagtgg attaaaatat       480
     gccaaagaga tagggagctt taccgttgca atcgcaagca atccacaaag tgctatggca       540
     aaaattgccg atattggcat cgaaactatt gtcggacctg agattttaac cggttcaagt       600
     cgcctgaaat ccggtacggc acaaaaattg gtgctgaata tgctaaccac tgcgagtatg       660
     gttttacttg ggaaatgtta tcaaaacctt atggttgatg tacaagcaag caatgaaaaa       720
     ctcgttgatc gagcgacaag aattattatg caagcaaccg gttgtgaacg agcgaaagca       780
     gagcaaacgc taacacaagc agataataat gcaaaactgg ctatcttaat gattttaatg       840
     gatttagata agcaaagtgc ggtggattta ttagcgaaaa atcaagataa attacgccaa       900
     acgttagact ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page